DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1941 and K07B1.4

Sequence 1:NP_001286161.1 Gene:CG1941 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_505413.1 Gene:K07B1.4 WormBaseID:WBGene00019464 Length:349 Species:Caenorhabditis elegans

Alignment Length:349 Identity:130/350 (37%)
Similarity:201/350 (57%) Gaps:38/350 (11%)


  Fly     3 IEWAPKGVPMERRRQTFAMAFLILSFMILSFGSYFFVAAVLFY--GSLLWRTIMV--IYLVYVYA 63
            :||||..:|:.||.||..    .|.|..::..:...|..|.||  .::||..|.:  ::::|.:.
 Worm    17 VEWAPLNIPLARRLQTLG----ALHFFFITLFTPVLVLTVPFYMLYTVLWPLIFLYGLWMIYDWN 77

  Fly    64 NHKRTHSIMDGNGWKINRNNWLFRH-----YRDYFPVQLVKTAELPPNKNYILASFPHGILGTGI 123
            :.|:...:          :||..|.     |.:||||:|..|:::|...||::...||||:....
 Worm    78 SPKKGAYM----------SNWFQRQRIHSWYANYFPVKLHTTSDMPEEHNYLIGYHPHGIISMAA 132

  Fly   124 SINMGLDISKWLQLFPQVRPKVATLDQNFLTPIVR--GLLRSWGLVSVSKEALVYLLTKSNDPKH 186
            .||...:.:..|...|::|..:.||...|.||..|  |||.  |::..|:|::.::|  .::.|.
 Worm   133 FINFATNGTGILDTLPRIRFHLCTLVGQFWTPWRREWGLLH--GMIDCSRESIKHVL--EHEKKG 193

  Fly   187 KDNRDGFTSNAVAILVGGAQEALDSHPGKYILTLKNRKGFVKMAIRTGSSIVPTFSFGEVDILDQ 251
            |         ||.::||||:||||:|||.:|||||.||||||:|::||:.:||.:||||.||.:|
 Worm   194 K---------AVVLVVGGAEEALDAHPGCHILTLKKRKGFVKIALQTGAQLVPCYSFGENDIFNQ 249

  Fly   252 VANPPNSRVRRFQDFVKRITGISPLIPVGRGIFNYSFGFLPNRRRIVQVVGAPIDVVQSDQPDAA 316
            ..||..|.:|:||..:||:.|.||....|||:|||:||.||.|:.|..|:||||.|.::..|...
 Worm   250 AENPKGSTIRQFQTIMKRVLGFSPPAFYGRGVFNYTFGLLPFRKPINTVLGAPISVTKTVNPTQE 314

  Fly   317 YVDKIHKQVIDDLEKMFAKYKDQY 340
            .:|.:|:..:|.|.::|.::|.:|
 Worm   315 QIDTLHQTYMDRLHELFEEHKTKY 338

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 113/299 (38%)
K07B1.4NP_505413.1 DAGAT 54..349 CDD:112781 117/309 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C42867883
eggNOG 1 0.900 E1_KOG0831
Hieranoid 1 1.000
Homologene 1 1.000 H57020
Inparanoid 1 1.050 236 1.000 Inparanoid score I2111
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1347007at2759
OrthoFinder 1 1.000 FOG0000187
OrthoInspector 1 1.000 T97970
orthoMCL 1 0.900 OOG5_127120
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.982 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R305
TreeFam 1 0.960
1312.700

Return to query results.
Submit another query.