DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1941 and Y53G8B.2

Sequence 1:NP_001286161.1 Gene:CG1941 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_497659.1 Gene:Y53G8B.2 WormBaseID:WBGene00021818 Length:340 Species:Caenorhabditis elegans

Alignment Length:353 Identity:123/354 (35%)
Similarity:189/354 (53%) Gaps:45/354 (13%)


  Fly     3 IEWAPKGVPMERRRQTFAMAFLILSFMILSFGSYFFVAAVLFYGSLL----WRTIMVIYLVYVYA 63
            |||......::|::....:.:   .|| |::....||..:.|:  ||    |. |:.:|..:.:.
 Worm     7 IEWVDLFSSIQRKKTYLGVVY---HFM-LTYPLALFVTILPFF--LLFTFQWH-ILALYACWYFY 64

  Fly    64 NHKRTHSIMDG-----------NGWKINRNNWLFRHYRDYFPVQLVKTAELPPNKNYILASFPHG 117
            :       ||.           ..|::  |:|    :..|||:.|.|||||..:|||::...|||
 Worm    65 D-------MDSPRRGGYSSDWVRKWRV--NDW----FAQYFPINLHKTAELSTDKNYLVGIHPHG 116

  Fly   118 ILGTGISINMGLDISKWLQLFPQVRPKVATLDQNFLTPIVRGLLRSWGLVSVSKEALVYLLTKSN 182
            |:......|...:.:...:.||.:|..:.||...|...|.|.||...||:..|:|::.|:|.|. 
 Worm   117 IISMAAWSNFATNGTGIYEKFPGIRWNLCTLALQFRMAIRRELLLLTGLIDCSRESIEYVLDKC- 180

  Fly   183 DPKHKDNRDGFTSNAVAILVGGAQEALDSHPGKYILTLKNRKGFVKMAIRTGSSIVPTFSFGEVD 247
                     |....||.:::|||:||||:|||.:.|||.:|||||:.|:.||:.:||.:||||.|
 Worm   181 ---------GQKGRAVVLVIGGAEEALDAHPGYHTLTLASRKGFVREALITGAYLVPVYSFGEND 236

  Fly   248 ILDQVANPPNSRVRRFQDFVKRITGISPLIPVGRGIFNYSFGFLPNRRRIVQVVGAPIDVVQSDQ 312
            :.:|:.||..||:|.||::.|.|.|||..|..|||.|..:||:||.|:.|..||||||.|.:.:.
 Worm   237 VFEQMENPVGSRLRNFQEWCKSIFGISYPIFHGRGFFQLTFGYLPFRKPIDTVVGAPIPVEKVEN 301

  Fly   313 PDAAYVDKIHKQVIDDLEKMFAKYKDQY 340
            |....:|::|......|.::|.::|::|
 Worm   302 PTKEQIDELHTIYCQKLTELFDEHKEKY 329

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 110/301 (37%)
Y53G8B.2NP_497659.1 DAGAT 44..340 CDD:112781 114/313 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C42867920
eggNOG 1 0.900 E1_KOG0831
Hieranoid 1 1.000
Homologene 1 1.000 H57020
Inparanoid 1 1.050 236 1.000 Inparanoid score I2111
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1347007at2759
OrthoFinder 1 1.000 FOG0000187
OrthoInspector 1 1.000 T97970
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.982 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R305
TreeFam 00.000 Not matched by this tool.
1110.840

Return to query results.
Submit another query.