DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1941 and AWAT2

Sequence 1:NP_001286161.1 Gene:CG1941 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001002254.1 Gene:AWAT2 HGNCID:23251 Length:333 Species:Homo sapiens

Alignment Length:350 Identity:109/350 (31%)
Similarity:178/350 (51%) Gaps:27/350 (8%)


  Fly    10 VPMERRRQTFAMAFLILSFMILSFGSYFFVAAVLFYGSLL------WR-TIMVI-YLVYVYANHK 66
            :|.::..:|....|.:..:   ||.:......|:.....|      |. |:::: :|.:.:...:
Human     3 LPSKKDLKTALDVFAVFQW---SFSALLITTTVIAVNLYLVVFTPYWPVTVLILTWLAFDWKTPQ 64

  Fly    67 RTHSIMDGNGWKINRNNWLFRHYRDYFPVQLVKTAELPPNKNYILASFPHGILGTGISINMGLDI 131
            |     .|..:...|:..|::||.||||::|:||.::.|::||||...|||:...|...:...:.
Human    65 R-----GGRRFTCVRHWRLWKHYSDYFPLKLLKTHDICPSRNYILVCHPHGLFAHGWFGHFATEA 124

  Fly   132 SKWLQLFPQVRPKVATLDQNFLTPIVRGLLRSWGLVSVSKEALVYLLTKSNDPKHKDNRDGFTSN 196
            |.:.::||.:.|.:.||...|..|.:|..:.|.|..|||:.::.:|||      ||.     |.|
Human   125 SGFSKIFPGITPYILTLGAFFWMPFLREYVMSTGACSVSRSSIDFLLT------HKG-----TGN 178

  Fly   197 AVAILVGGAQEALDSHPGKYILTLKNRKGFVKMAIRTGSSIVPTFSFGEVDILDQVANPPNSRVR 261
            .|.:::||..|...|.||...|.||||.|||:||::.|..::|.::|||.|:.||....|...|.
Human   179 MVIVVIGGLAECRYSLPGSSTLVLKNRSGFVRMALQHGVPLIPAYAFGETDLYDQHIFTPGGFVN 243

  Fly   262 RFQDFVKRITGISPLIPVGRGIFNYSFGFLPNRRRIVQVVGAPIDVVQSDQPDAAYVDKIHKQVI 326
            |||.:.:.:..|.|....|||....|:|.||..|.:..:||.|:.:.:.:.|....|.|.|...|
Human   244 RFQKWFQSMVHIYPCAFYGRGFTKNSWGLLPYSRPVTTIVGEPLPMPKIENPSQEIVAKYHTLYI 308

  Fly   327 DDLEKMFAKYKDQYIPNSKQDKLII 351
            |.|.|:|.::|.::..:..|:..||
Human   309 DALRKLFDQHKTKFGISETQELEII 333

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 99/292 (34%)
AWAT2NP_001002254.1 LPLAT 38..332 CDD:302626 101/310 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C43711112
eggNOG 1 0.900 E1_KOG0831
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 235 1.000 Inparanoid score I3345
Isobase 1 0.950 0 Normalized mean entropy S1864
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1347007at2759
OrthoFinder 1 1.000 FOG0000187
OrthoInspector 1 1.000 T130066
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12317
Phylome 1 0.910 0.613 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
109.810

Return to query results.
Submit another query.