DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1941 and AWAT1

Sequence 1:NP_001286161.1 Gene:CG1941 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_016884784.1 Gene:AWAT1 HGNCID:23252 Length:395 Species:Homo sapiens

Alignment Length:400 Identity:117/400 (29%)
Similarity:174/400 (44%) Gaps:87/400 (22%)


  Fly    12 MERRRQTFAMAFLILSFMILSFGSYFFVAAVLFYGSL---LWRTIMVIYLVYVYANHKRTHSIMD 73
            |...:|......|:|....||:.:.|::...||...|   || .:.|:|..:::.:.|.......
Human     1 MAHSKQPSHFQSLMLLQWPLSYLAIFWILQPLFVYLLFTSLW-PLPVLYFAWLFLDWKTPERGGR 64

  Fly    74 GNGWKINRNNW-LFRHYRDYFPVQLVKTAELPPNKNYILASFPHGILGTGISINMGLDISKWLQL 137
            .:.|.   .|| ::.|.|||||:.::||.:|.|..||::...|||:|..|...|...:.:.:.:.
Human    65 RSAWV---RNWCVWTHIRDYFPITILKTKDLSPEHNYLMGVHPHGLLTFGAFCNFCTEATGFSKT 126

  Fly   138 FPQVRPKVATLDQNFLTPIVRGLLRSWGLVSVSKEALVYLLTKSNDPKHKDNRDGFTSNAVAILV 202
            ||.:.|.:|||...|..|.||..|.:.|:.|||:.|:.|||:..            |.|.|.|:|
Human   127 FPGITPHLATLSWFFKIPFVREYLMAKGVCSVSQPAINYLLSHG------------TGNLVGIVV 179

  Fly   203 GGAQEALDSHPGKYILTLKNRKGFVKMAIRTGSSIVPTFSFGEVDILDQVANPPNSRVRRFQDFV 267
            ||..|||.|.|....|.|:.|||||:.|::.|:.:||||:|||.::.|||....:||:.:||...
Human   180 GGVGEALQSVPNTTTLILQKRKGFVRTALQHGAHLVPTFTFGETEVYDQVLFHKDSRMYKFQSCF 244

  Fly   268 KRITGISPLIPVGRGIFNYSFGFLPNRRRIVQV-------------------------------- 300
            :||.|....:..|:.....|.|.||..|.||.|                                
Human   245 RRIFGFYCCVFYGQSFCQGSTGLLPYSRPIVTVGECHSQPQCHLRFLNLNLSLAPPKKRAAEGKV 309

  Fly   301 -----------------------------------VGAPIDVVQSDQPDAAYVDKIHKQVIDDLE 330
                                               ||.|:.:.|.::|....|||.|...:|.|.
Human   310 GADLGCESQAQGRRGRLKEEEVLTLSSSLFRSLLAVGEPLPLPQIEKPSQEMVDKYHALYMDALH 374

  Fly   331 KMFAKYKDQY 340
            |:|.::|..|
Human   375 KLFDQHKTHY 384

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 105/358 (29%)
AWAT1XP_016884784.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C43748923
eggNOG 1 0.900 E1_KOG0831
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 235 1.000 Inparanoid score I3345
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1347007at2759
OrthoFinder 1 1.000 FOG0000187
OrthoInspector 1 1.000 T130066
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12317
Phylome 1 0.910 0.616 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.