DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1941 and DUSP14

Sequence 1:NP_001286161.1 Gene:CG1941 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_008957.1 Gene:DUSP14 HGNCID:17007 Length:198 Species:Homo sapiens

Alignment Length:163 Identity:34/164 (21%)
Similarity:53/164 (32%) Gaps:63/164 (38%)


  Fly   100 TAELP----PNKNYI---LASFPHGILGTGISINMGLDISKWLQLFPQVRPKVATLDQNFLTPIV 157
            |.|:|    |...|:   ||..||..:|.               .|..|..|:.::.:.....:|
Human    60 TIEIPNFNWPQFEYVKVPLADMPHAPIGL---------------YFDTVADKIHSVSRKHGATLV 109

  Fly   158 R---GLLRSWGLVSVSKEALVYLL-------------TKSNDPKHKDNRDGFTSNAVAILVGGAQ 206
            .   |:.||..|      .:.||:             .|:..|..:.|            ||..:
Human   110 HCAAGVSRSATL------CIAYLMKFHNVCLLEAYNWVKARRPVIRPN------------VGFWR 156

  Fly   207 EALDSHPGKYILTLKNRKGFVKMAIRTGSSIVP 239
            :.:|.....:      .|..||| ::|...|||
Human   157 QLIDYERQLF------GKSTVKM-VQTPYGIVP 182

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 34/164 (21%)
DUSP14NP_008957.1 DSPc 26..162 CDD:238073 26/135 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1347007at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.