DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1941 and mogat3

Sequence 1:NP_001286161.1 Gene:CG1941 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_012808859.1 Gene:mogat3 XenbaseID:XB-GENE-959736 Length:306 Species:Xenopus tropicalis

Alignment Length:300 Identity:103/300 (34%)
Similarity:163/300 (54%) Gaps:37/300 (12%)


  Fly    12 MERRRQTFAMAFLILSFMILSFGSYFFVAAVLFYGSLLWRTIMVIYLVYVYANHKRTHSIMDGNG 76
            |.:..|:.::...:|:|:::  |..|.:..|....:.|| .|.|:|..::         ::|   
 Frog    30 MRKHIQSLSVFQWVLTFLLM--GITFTILLVYMLFTSLW-LIPVVYFTWL---------LLD--- 79

  Fly    77 WKI-----NRNNWLFR-----HYRDYFPVQLVKTAELPPNKNYILASFPHGILGTGISINMGLDI 131
            |:.     .|..|:.|     |:||||||:||.:|.|.|::|||:...||||:.:....|...:.
 Frog    80 WETPERGGRRVEWVRRWPIWVHFRDYFPVKLVSSAPLSPDRNYIVGCHPHGIMASSSFCNFATEA 144

  Fly   132 SKWLQLFPQVRPKVATLDQNFLTPIVRGLLRSWGLVSVSKEALVYLLTKSNDPKHKDNRDGFTSN 196
            ..:..|:|.|||.:|.|...|..|:.|..|.|.|:|.|||::|.|||::..           :.|
 Frog   145 GGFSLLYPGVRPWLAILAGLFRMPLYRDYLMSAGMVPVSKDSLQYLLSRCG-----------SGN 198

  Fly   197 AVAILVGGAQEALDSHPGKYILTLKNRKGFVKMAIRTGSSIVPTFSFGEVDILDQVANPPNSRVR 261
            ||.|:||||.|:|.|.|||:.:||..|||||::|::.|:.::|.:||||.::.:||...|:|...
 Frog   199 AVFIVVGGAAESLQSIPGKHSVTLSGRKGFVRLALQNGADLLPVYSFGENELYEQVCLSPDSWGW 263

  Fly   262 RFQDFVKRITGISPLIPVGRGIFNYS-FGFLPNRRRIVQV 300
            |.|...::..|.:|.:..||.:|:.| :|..|..|.|..|
 Frog   264 RLQRLFQKHVGFAPCLFKGRAVFSESGWGLNPFPRPITTV 303

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 95/262 (36%)
mogat3XP_012808859.1 LPLAT 59..303 CDD:302626 95/268 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C43733277
eggNOG 1 0.900 E1_KOG0831
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1347007at2759
OrthoFinder 1 1.000 FOG0000187
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.641 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.