DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1941 and mogat2.2

Sequence 1:NP_001286161.1 Gene:CG1941 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_002941212.2 Gene:mogat2.2 XenbaseID:XB-GENE-5764957 Length:335 Species:Xenopus tropicalis

Alignment Length:360 Identity:131/361 (36%)
Similarity:201/361 (56%) Gaps:45/361 (12%)


  Fly     1 MKIEWAPKGVPMERRRQTFAMAFLILSFMILSFGSYFFVAAVLFYGSLLWR--TIMVIYLVYVY- 62
            ||:::||:.:|:|||.||.|:...:.||:.|:     ....:||:..|..|  .|.|.|.|:.: 
 Frog     1 MKVQFAPRNLPLERRLQTAAVLQWVYSFLALA-----QTCIILFFVLLFTRFWIISVAYGVWWFL 60

  Fly    63 -----------ANHKRTHSIMDGNGWKINRNNWLFRHYRDYFPVQLVKTAELPPNKNYILASFPH 116
                       :...|||::            |  |:.|||||:.||||.:|.|.:||:|.|.||
 Frog    61 DWDTPSKGGRRSQRLRTHAV------------W--RYMRDYFPITLVKTVDLDPQQNYLLGSHPH 111

  Fly   117 GILGTGISINMGLDISKWLQLFPQVRPKVATLDQNFLTPIVRGLLRSWGLVSVSKEALVYLLTKS 181
            |:|..|...|...:.:.:.:|||.:.|.:..|...|..|..|..:...||:...|::..|||   
 Frog   112 GVLVAGAFTNFCTEATGFQKLFPGITPYLLMLPLWFRAPFFRDYIMGGGLIPSDKDSASYLL--- 173

  Fly   182 NDPKHKDNRDGFTSNAVAILVGGAQEALDSHPGKYILTLKNRKGFVKMAIRTGSSIVPTFSFGEV 246
                  .|:.|  .||:.|.||||.|:|::.||.:.|.|||||||:|:||..|:|:||.|||||.
 Frog   174 ------KNKAG--GNAIVIAVGGAPESLNARPGAFTLLLKNRKGFIKLAILHGASLVPVFSFGEN 230

  Fly   247 DILDQVANPPNSRVRRFQDFVKRITGISPLIPVGRGIFNYSFGFLPNRRRIVQVVGAPIDVVQSD 311
            ::.|||.||..|.:|..|:.::.|.|::..:...||:|.||||.:|.|:.|..|||.||.|:::.
 Frog   231 ELFDQVDNPRGSWLRTIQEKLQGIMGVALPLFHARGVFQYSFGLIPYRKPIATVVGKPIKVMENP 295

  Fly   312 QPDAAYVDKIHKQVIDDLEKMFAKYKDQY-IPNSK 345
            .|....::::||..:::|.|:|.::|.:| :|..|
 Frog   296 NPTNEEIERLHKIYMEELSKLFEEHKAKYNVPADK 330

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 111/304 (37%)
mogat2.2XP_002941212.2 LPLAT 40..334 CDD:302626 115/317 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C43723392
eggNOG 1 0.900 E1_KOG0831
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H57020
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1347007at2759
OrthoFinder 1 1.000 FOG0000187
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.680 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.