DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1941 and mogat3a

Sequence 1:NP_001286161.1 Gene:CG1941 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_021325732.1 Gene:mogat3a ZFINID:ZDB-GENE-080305-11 Length:335 Species:Danio rerio

Alignment Length:347 Identity:125/348 (36%)
Similarity:183/348 (53%) Gaps:30/348 (9%)


  Fly     1 MKIEWAPKGVPMERRRQTFAMAFLILSFMILSFGSYFFVAAVLFYGSLLWRTIMVIYLVYVYANH 65
            ||||:||..||:.||.||.|:...:.||:.|   :...:||.:......|..:..:|..::|.:.
Zfish     1 MKIEFAPLRVPLRRRIQTAAVVQWVFSFLAL---AQVCLAAFVLLCLSDWWMLGALYAGWLYLDR 62

  Fly    66 -------KRTHSIMDGNGWKINRNNWLFRHYRDYFPVQLVKTAELPPNKNYILASFPHGILGTGI 123
                   :|:..:   ..|:|    |:  |:|||||:.||||.:|.|..||:|...|||:|..|.
Zfish    63 DTPSCGGRRSQWV---RSWRI----WM--HFRDYFPITLVKTVDLDPRHNYLLGFHPHGVLVAGG 118

  Fly   124 SINMGLDISKWLQLFPQVRPKVATLDQNFLTPIVRGLLRSWGLVSVSKEALVYLLTKSNDPKHKD 188
            ..|...:.|.:.|:||.:.|.:..|...|..|..|..:...||||..|.:..|||.....     
Zfish   119 FGNFCTEASGFSQMFPGLTPYLLMLPFWFRVPFFREYIMCGGLVSSEKASASYLLGHPGG----- 178

  Fly   189 NRDGFTSNAVAILVGGAQEALDSHPGKYILTLKNRKGFVKMAIRTGSSIVPTFSFGEVDILDQVA 253
                  ..|..|.||||.|:|::.||...|.|..||||:|:|::.|:.:||.|||||.::.||:.
Zfish   179 ------GQAAVIAVGGAPESLEARPGALTLQLLQRKGFIKLALKHGAWLVPVFSFGENELFDQME 237

  Fly   254 NPPNSRVRRFQDFVKRITGISPLIPVGRGIFNYSFGFLPNRRRIVQVVGAPIDVVQSDQPDAAYV 318
            ||..|.:||.|:.::||.|::..:...||:|.||||.||.|:.|..|||.||.|.|:..|....:
Zfish   238 NPAGSALRRMQERLQRIMGVALPLFHARGVFQYSFGLLPYRKPIHTVVGRPIPVSQTPCPSKEDI 302

  Fly   319 DKIHKQVIDDLEKMFAKYKDQY 340
            |.:|...:..|.::|.:.|..|
Zfish   303 DALHTLYMQGLTQVFEENKKHY 324

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 106/297 (36%)
mogat3aXP_021325732.1 LPLAT 39..334 CDD:327403 107/307 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C43714950
eggNOG 1 0.900 E1_KOG0831
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1347007at2759
OrthoFinder 1 1.000 FOG0000187
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12317
Phylome 1 0.910 0.655 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.