DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1941 and dgat2l6

Sequence 1:NP_001286161.1 Gene:CG1941 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_002934939.1 Gene:dgat2l6 XenbaseID:XB-GENE-5928098 Length:361 Species:Xenopus tropicalis

Alignment Length:347 Identity:120/348 (34%)
Similarity:184/348 (53%) Gaps:36/348 (10%)


  Fly     6 APKGVPMERRR---QTFAMAFLILSFMILSFGSYFFVAAVLFYGSLLWRTIMVIYLVYVY----- 62
            |...:|.::.|   |.||:...|.||:::...:...:..:.|.|  || .:..:|:.::.     
 Frog    28 ATPALPQQQLRPCLQLFAVLQWIFSFLVMGLLALVILIYLFFTG--LW-PVSALYISWILLDWDT 89

  Fly    63 --ANHKRTHSIMDGNGWKINRNNW-LFRHYRDYFPVQLVKTAELPPNKNYILASFPHGILGTGIS 124
              ...:|:|.:          .|| ::.::|||||::||||..|||.:|||:.|.|||||.....
 Frog    90 PETGGRRSHWV----------RNWAIWNYFRDYFPIKLVKTHSLPPGRNYIIGSHPHGILCIAAF 144

  Fly   125 INMGLDISKWLQLFPQVRPKVATLDQNFLTPIVRGLLRSWGLVSVSKEALVYLLTKSNDPKHKDN 189
            .|...:.:.:.:.||.:||.:|||..||..|::|..:.|.||..|:::|:.|:|::|.       
 Frog   145 CNFSTESTGFSKKFPGIRPYLATLAGNFRLPLLREYMMSGGLCPVNRKAISYVLSQSG------- 202

  Fly   190 RDGFTSNAVAILVGGAQEALDSHPGKYILTLKNRKGFVKMAIRTGSSIVPTFSFGEVDILDQVAN 254
                ..|||.|:||||.|:|...||...:.|..|:|||::|:..|:.:||:|||||.::..||..
 Frog   203 ----CGNAVVIVVGGAAESLSCQPGITTVILSRRRGFVRLALEQGADLVPSFSFGENELYQQVQF 263

  Fly   255 PPNSRVRRFQDFVKRITGISPLIPVGRGIFNY-SFGFLPNRRRIVQVVGAPIDVVQSDQPDAAYV 318
            |..|.:|..|...:::.|.:|....||||.:. |.||||..|.|..|||.||.|.:...|....|
 Frog   264 PEQSILRTAQWKFQKLFGFAPCFFYGRGITSIESKGFLPYPRPITTVVGEPISVPKIQDPSPQTV 328

  Fly   319 DKIHKQVIDDLEKMFAKYKDQY 340
            |..|......|.|:|.::|.||
 Frog   329 DLYHNMYKCSLLKLFHEHKTQY 350

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 107/299 (36%)
dgat2l6XP_002934939.1 DAGAT 66..360 CDD:112781 111/310 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C43691473
eggNOG 1 0.900 E1_KOG0831
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1347007at2759
OrthoFinder 1 1.000 FOG0000187
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.697 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.720

Return to query results.
Submit another query.