DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1941 and awat1

Sequence 1:NP_001286161.1 Gene:CG1941 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_012825452.1 Gene:awat1 XenbaseID:XB-GENE-5753328 Length:339 Species:Xenopus tropicalis

Alignment Length:337 Identity:122/338 (36%)
Similarity:183/338 (54%) Gaps:20/338 (6%)


  Fly    17 QTFAMAFLILSFMILSFGSYFFVAAVLFYGSLLWRTIMVIYLVYVYANHKRTHSIMDGNGWKINR 81
            |..|:...||:|:.|  |....:..:....|.|| .::.:|:|::.::.|....   |....:..
 Frog    20 QVLAVLKWILTFLFL--GPICVLIIIWISCSPLW-PLLALYMVWLVSDRKTPER---GGRKSVWM 78

  Fly    82 NNW-LFRHYRDYFPVQLVKTAELPPNKNYILASFPHGILGTGISINMGLDISKWLQLFPQVRPKV 145
            :.| :::|:||||||:|.|||||.|.:||||...||||:..|...|.|.|.:::.||||.::..:
 Frog    79 SKWTIWKHFRDYFPVRLHKTAELDPQQNYILGYHPHGIMSIGAFCNFGTDSTEFSQLFPGLKTYL 143

  Fly   146 ATLDQNFLTPIVRGLLRSWGLVSVSKEALVYLLTKSNDPKHKDNRDGFTSNAVAILVGGAQEALD 210
            .||..||..|..|..|.:.|:.||:..::.|||:...           |.|||.|:|||:.|||.
 Frog   144 TTLAGNFKVPFYRDYLLAAGMCSVTHSSIDYLLSHHG-----------TGNAVVIVVGGSAEALH 197

  Fly   211 SHPGKYILTLKNRKGFVKMAIRTGSSIVPTFSFGEVDILDQVANPPNSRVRRFQDFVKRITGISP 275
            .:...:||||||||||||.|:..|||:||.:||||.::|.|......|..:..|...:...|.:|
 Frog   198 CNRQSHILTLKNRKGFVKKALIHGSSLVPVYSFGENEVLHQCHFAVGSWKKSLQQMFQHWVGFAP 262

  Fly   276 LIPVGRGIF-NYSFGFLPNRRRIVQVVGAPIDVVQSDQPDAAYVDKIHKQVIDDLEKMFAKYKDQ 339
            .|..|:|.| :.|.|.||.|:.|..|||.||.:.:..:|....:.|.|...:..|.::|..:|::
 Frog   263 CIFYGQGFFSSTSKGILPFRKPINTVVGKPIPLPRVQKPSEEQIQKYHALYVGSLLELFNTHKER 327

  Fly   340 YIPNSKQDKLII 351
            : ...|.|.||:
 Frog   328 F-GLQKSDSLIL 338

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 109/292 (37%)
awat1XP_012825452.1 LPLAT 47..338 CDD:302626 115/307 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 227 1.000 Inparanoid score I3271
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1347007at2759
OrthoFinder 1 1.000 FOG0000187
OrthoInspector 1 1.000 T129109
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R305
TreeFam 00.000 Not matched by this tool.
55.090

Return to query results.
Submit another query.