DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: U2A and lrrc51

Sequence 1:NP_610315.1 Gene:U2A FlyBaseID:FBgn0033210 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_009290232.1 Gene:lrrc51 ZFINID:ZDB-GENE-060929-962 Length:185 Species:Danio rerio

Alignment Length:110 Identity:31/111 (28%)
Similarity:59/111 (53%) Gaps:23/111 (21%)


  Fly    47 IDLSDNDLRKLDNLPHLPRLKCLLLNNNRILRISEGLEEAVPNLGSIILTGNNLQELSDLEPLVG 111
            :|||.|:::.:|::  |.:||.|.|                     :.|.|||:||||:::.|..
Zfish    74 LDLSFNEIKHIDSV--LTQLKELRL---------------------LYLHGNNIQELSEVDKLAV 115

  Fly   112 FTKLETICLLINPVSTKPNYREYMAYKFPQLRLLDFRKIKQKDRQ 156
            ...|.||.|..||:.::.:||.::....|.::::||..:.:::|:
Zfish   116 LPSLHTITLHGNPIVSERDYRAHLIATLPHVKMIDFSAVTKQERE 160

Known Domains:


GeneSequenceDomainRegion External IDIdentity
U2ANP_610315.1 LRR_9 1..175 CDD:258718 31/111 (28%)
leucine-rich repeat 22..43 CDD:275380
LRR_4 46..81 CDD:289563 10/34 (29%)
leucine-rich repeat 46..65 CDD:275378 6/18 (33%)
leucine-rich repeat 66..89 CDD:275378 4/23 (17%)
leucine-rich repeat 90..114 CDD:275378 9/24 (38%)
lrrc51XP_009290232.1 LRR_8 69..129 CDD:290566 25/78 (32%)
LRR_4 69..112 CDD:289563 18/61 (30%)
leucine-rich repeat 71..93 CDD:275380 8/21 (38%)
leucine-rich repeat 94..118 CDD:275380 11/45 (24%)
leucine-rich repeat 119..145 CDD:275380 9/26 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1447031at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.