DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment U2A and lrrc51

DIOPT Version :9

Sequence 1:NP_610315.1 Gene:U2A / 35713 FlyBaseID:FBgn0033210 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_009290232.1 Gene:lrrc51 / 767801 ZFINID:ZDB-GENE-060929-962 Length:185 Species:Danio rerio


Alignment Length:110 Identity:31/110 - (28%)
Similarity:59/110 - (53%) Gaps:23/110 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 IDLSDNDLRKLDNLPHLPRLKCLLLNNNRILRISEGLEEAVPNLGSIILTGNNLQELSDLEPLVG 111
            :|||.|:::.:|::  |.:||.|.|                     :.|.|||:||||:::.|..
Zfish    74 LDLSFNEIKHIDSV--LTQLKELRL---------------------LYLHGNNIQELSEVDKLAV 115

  Fly   112 FTKLETICLLINPVSTKPNYREYMAYKFPQLRLLDFRKIKQKDRQ 156
            ...|.||.|..||:.::.:||.::....|.::::||..:.:::|:
Zfish   116 LPSLHTITLHGNPIVSERDYRAHLIATLPHVKMIDFSAVTKQERE 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
U2ANP_610315.1 LRR_9 1..175 CDD:258718 31/110 (28%)
leucine-rich repeat 22..43 CDD:275380
LRR_4 46..81 CDD:289563 10/33 (30%)
leucine-rich repeat 46..65 CDD:275378 6/17 (35%)
leucine-rich repeat 66..89 CDD:275378 4/22 (18%)
leucine-rich repeat 90..114 CDD:275378 9/23 (39%)
lrrc51XP_009290232.1 LRR_8 69..129 CDD:290566 24/77 (31%)
LRR_4 69..112 CDD:289563 18/60 (30%)
leucine-rich repeat 71..93 CDD:275380 7/20 (35%)
leucine-rich repeat 94..118 CDD:275380 11/44 (25%)
leucine-rich repeat 119..145 CDD:275380 8/25 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1447031at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.