DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: U2A and Snrpa1

Sequence 1:NP_610315.1 Gene:U2A FlyBaseID:FBgn0033210 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_067311.4 Gene:Snrpa1 MGIID:1916231 Length:255 Species:Mus musculus

Alignment Length:256 Identity:133/257 (52%)
Similarity:174/257 (68%) Gaps:19/257 (7%)


  Fly     1 MVKLTPELINQSMQYINPCRERELDLRGYKIPQIENLGATLDQFDTIDLSDNDLRKLDNLPHLPR 65
            |||||.|||.|:.||.|..|:|||||||||||.||||||||||||.||.|||::||||..|.|.|
Mouse     1 MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRR 65

  Fly    66 LKCLLLNNNRILRISEGLEEAVPNLGSIILTGNNLQELSDLEPLVGFTKLETICLLINPVSTKPN 130
            ||.||:|||||.||.|||::|:|.|..:|||.|:|.||.||:||.....|..:.:|.|||:.|.:
Mouse    66 LKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKH 130

  Fly   131 YREYMAYKFPQLRLLDFRKIKQKDRQAAQEFFRTKQGKDVLKEISRKSK-MSAAAAIAAEAGNGK 194
            ||.|:.||.||:|:|||:|:|.|:||.|::.|:.|:|..:.|:|:|:|| .:..|.:..:...| 
Mouse   131 YRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKG- 194

  Fly   195 GRGSEGGRLANPQDMQRIREAIKRASSLAEVERLSQILQSGQLP---------DKFQHEME 246
              |...|      |::.|:.||..||:|||||||..:|||||:|         |:.:.|:|
Mouse   195 --GPSAG------DVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPSDEGEEEIE 247

Known Domains:


GeneSequenceDomainRegion External IDIdentity
U2ANP_610315.1 LRR_9 1..175 CDD:258718 104/174 (60%)
leucine-rich repeat 22..43 CDD:275380 20/21 (95%)
LRR_4 46..81 CDD:289563 23/35 (66%)
leucine-rich repeat 46..65 CDD:275378 11/19 (58%)
leucine-rich repeat 66..89 CDD:275378 16/23 (70%)
leucine-rich repeat 90..114 CDD:275378 12/24 (50%)
Snrpa1NP_067311.4 LRR_9 1..175 CDD:317038 104/174 (60%)
LRR 1 20..41 19/21 (90%)
leucine-rich repeat 22..43 CDD:275378 20/21 (95%)
LRR 2 43..64 14/21 (67%)
leucine-rich repeat 44..65 CDD:275378 13/21 (62%)
LRR 3 65..86 15/21 (71%)
leucine-rich repeat 66..89 CDD:275378 16/23 (70%)
LRR 4 89..110 12/21 (57%)
leucine-rich repeat 90..114 CDD:275378 12/24 (50%)
leucine-rich repeat 115..127 CDD:275378 5/12 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C31385567
eggNOG 1 0.900 E2759_KOG1644
Hieranoid 1 1.000
Homologene 1 1.000 H2325
Inparanoid 1 1.050 244 1.000 Inparanoid score I3262
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1447031at2759
OrthoFinder 1 1.000 FOG0004050
OrthoInspector 1 1.000 T1083713
orthoMCL 1 0.900 OOG5_128407
Panther 1 1.100 LDO PTHR10552
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1269
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.