DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: U2A and Lrrc51

Sequence 1:NP_610315.1 Gene:U2A FlyBaseID:FBgn0033210 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001099754.1 Gene:Lrrc51 RGDID:1565856 Length:192 Species:Rattus norvegicus

Alignment Length:162 Identity:42/163 (26%)
Similarity:65/163 (40%) Gaps:47/163 (29%)


  Fly    25 DLRGYK--IPQI----ENLGATLDQFDTIDLSDNDLRKLDNLPHLPRLKCLLLNNNRILRISEGL 83
            ||:.:.  :.|:    |||.       .||||.|||..:|     |.|....             
  Rat    63 DLKDFNQVVSQLLQHPENLA-------WIDLSFNDLTTID-----PVLTTFF------------- 102

  Fly    84 EEAVPNLGSIILTGNNLQELSDLEPLVGFTKLETICLLINPVSTKPNYREYMAYKFPQLRLLDFR 148
                 ||..:.|.||::..|.::..|....:|.::.|..||:..:..||:|:....|::...||.
  Rat   103 -----NLSVLYLHGNSIHRLGEVNKLAVLPRLRSLTLHGNPIEEEKGYRQYVLCNLPRITTFDFS 162

  Fly   149 KIKQKDRQAAQEF---------FRTKQGKDVL 171
            .:.:.||..|:.:         .|.||  |||
  Rat   163 GVTKADRSTAEVWKRMNIKPKKVRIKQ--DVL 192

Known Domains:


GeneSequenceDomainRegion External IDIdentity
U2ANP_610315.1 LRR_9 1..175 CDD:258718 42/163 (26%)
leucine-rich repeat 22..43 CDD:275380 6/24 (25%)
LRR_4 46..81 CDD:289563 10/35 (29%)
leucine-rich repeat 46..65 CDD:275378 9/19 (47%)
leucine-rich repeat 66..89 CDD:275378 1/23 (4%)
leucine-rich repeat 90..114 CDD:275378 6/24 (25%)
Lrrc51NP_001099754.1 LRR 1 49..71 2/8 (25%)
leucine-rich repeat 52..80 CDD:275380 4/17 (24%)
LRR_8 80..139 CDD:290566 23/89 (26%)
LRR 2 80..101 12/33 (36%)
leucine-rich repeat 81..103 CDD:275380 11/52 (21%)
LRR 3 103..124 7/21 (33%)
leucine-rich repeat 104..128 CDD:275380 6/24 (25%)
leucine-rich repeat 129..155 CDD:275380 8/26 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1447031at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.