DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment U2A and Lrrc51

DIOPT Version :9

Sequence 1:NP_610315.1 Gene:U2A / 35713 FlyBaseID:FBgn0033210 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001099754.1 Gene:Lrrc51 / 293156 RGDID:1565856 Length:192 Species:Rattus norvegicus


Alignment Length:162 Identity:42/162 - (25%)
Similarity:65/162 - (40%) Gaps:47/162 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DLRGYK--IPQI----ENLGATLDQFDTIDLSDNDLRKLDNLPHLPRLKCLLLNNNRILRISEGL 83
            ||:.:.  :.|:    |||.       .||||.|||..:|     |.|....             
  Rat    63 DLKDFNQVVSQLLQHPENLA-------WIDLSFNDLTTID-----PVLTTFF------------- 102

  Fly    84 EEAVPNLGSIILTGNNLQELSDLEPLVGFTKLETICLLINPVSTKPNYREYMAYKFPQLRLLDFR 148
                 ||..:.|.||::..|.::..|....:|.::.|..||:..:..||:|:....|::...||.
  Rat   103 -----NLSVLYLHGNSIHRLGEVNKLAVLPRLRSLTLHGNPIEEEKGYRQYVLCNLPRITTFDFS 162

  Fly   149 KIKQKDRQAAQEF---------FRTKQGKDVL 171
            .:.:.||..|:.:         .|.||  |||
  Rat   163 GVTKADRSTAEVWKRMNIKPKKVRIKQ--DVL 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
U2ANP_610315.1 LRR_9 1..175 CDD:258718 42/162 (26%)
leucine-rich repeat 22..43 CDD:275380 6/23 (26%)
LRR_4 46..81 CDD:289563 10/34 (29%)
leucine-rich repeat 46..65 CDD:275378 8/18 (44%)
leucine-rich repeat 66..89 CDD:275378 1/22 (5%)
leucine-rich repeat 90..114 CDD:275378 6/23 (26%)
Lrrc51NP_001099754.1 LRR 1 49..71 2/7 (29%)
leucine-rich repeat 52..80 CDD:275380 3/16 (19%)
LRR 2 80..101 12/32 (38%)
leucine-rich repeat 81..103 CDD:275380 11/51 (22%)
LRR_9 <89..173 CDD:405295 25/106 (24%)
LRR 3 103..124 6/20 (30%)
leucine-rich repeat 104..128 CDD:275380 6/23 (26%)
leucine-rich repeat 129..155 CDD:275380 7/25 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1447031at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.