DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt1 and GK5

DIOPT Version :10

Sequence 1:NP_477473.1 Gene:Rpt1 / 35701 FlyBaseID:FBgn0028687 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001034636.1 Gene:GK5 / 256356 HGNCID:28635 Length:529 Species:Homo sapiens


Alignment Length:77 Identity:23/77 - (29%)
Similarity:34/77 - (44%) Gaps:28/77 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KYQIHIPLPP-KIDPTVT----MMQVE--------DKP-DVTYSDVGGC------------KEQI 184
            |.:||||:.. :.|..|.    :||:.        |:| |:..|.:|..            ||::
Human   425 KKEIHIPVRKIRADGGVCKNGFVMQMTSDLINENIDRPADIDMSCLGAASLAGLAVGFWTDKEEL 489

  Fly   185 EKLR--EVVETP 194
            :|||  |||..|
Human   490 KKLRQSEVVFKP 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt1NP_477473.1 PRK03992 88..430 CDD:179699 23/77 (30%)
GK5NP_001034636.1 ASKHA_NBD_FGGY_GK5-like 20..520 CDD:466803 23/77 (30%)

Return to query results.
Submit another query.