DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1603 and TFIIIA

Sequence 1:NP_001260778.1 Gene:CG1603 FlyBaseID:FBgn0033185 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001322779.1 Gene:TFIIIA AraportID:AT1G72050 Length:427 Species:Arabidopsis thaliana

Alignment Length:145 Identity:36/146 (25%)
Similarity:65/146 (45%) Gaps:22/146 (15%)


  Fly   448 YLCSFCPRRFDRHVDMDRHKLRSHFERKLKCQYCEKSFAVDTDLKVHTLIHTGERPHVCDICGKT 512
            |||.:|.....::..:.:| ::||.:.:|:.:..:::..||.:         ....|.|..||..
plant    35 YLCQYCGISRSKNYLITKH-IQSHHQMELEEERDDEACEVDEE---------SSSNHTCQECGAE 89

  Fly   513 FRLKLLLDHHVNGVHLNIRPYSCNM--CTKTFRKKFELANHI---KGHLNIRDKKC--EYCDATF 570
            |:....|..|:.. |...|.::|.:  |..::|:|..|..|:   ||.|    .||  |.|.:.|
plant    90 FKKPAHLKQHMQS-HSLERSFTCYVDDCAASYRRKDHLNRHLLTHKGKL----FKCPKENCKSEF 149

  Fly   571 YDHSSLSRHRRSHRS 585
            ....::.||.:.:.|
plant   150 SVQGNVGRHVKKYHS 164

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1603NP_001260778.1 MADF_DNA_bdg 202..287 CDD:287510
GT1 321..408 CDD:304916
C2H2 Zn finger 420..441 CDD:275368
COG5048 <424..583 CDD:227381 35/142 (25%)
C2H2 Zn finger 450..471 CDD:275368 4/21 (19%)
C2H2 Zn finger 478..498 CDD:275368 2/20 (10%)
zf-H2C2_2 490..513 CDD:290200 4/23 (17%)
C2H2 Zn finger 506..527 CDD:275368 6/21 (29%)
C2H2 Zn finger 535..555 CDD:275368 8/25 (32%)
C2H2 Zn finger 563..583 CDD:275368 6/22 (27%)
TFIIIANP_001322779.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24403
Phylome 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.