DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1603 and znf507

Sequence 1:NP_001260778.1 Gene:CG1603 FlyBaseID:FBgn0033185 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_004913609.1 Gene:znf507 XenbaseID:XB-GENE-1032939 Length:911 Species:Xenopus tropicalis

Alignment Length:651 Identity:120/652 (18%)
Similarity:205/652 (31%) Gaps:214/652 (33%)


  Fly    18 LKCLYCSIESELKDWELFIVHVKSAHYCEDED-VRINEIKEDTEELYSVVDAADPAIAYGPDEFF 81
            |.|..|.|  ..|..|....|:|.  :||.|| :...:.|:               ::..|| |.
 Frog   138 LMCSECHI--TFKKHEDLEGHIKK--HCETEDTLHPQQCKQ---------------LSTSPD-FP 182

  Fly    82 EVI------------------------ENSNGVDQWMEADSKDIQY----EEDATAWSAATNNSW 118
            |.:                        :.......|..|...|..|    ||:.:|..       
 Frog   183 EKVRKKWYAHEDYGLYRCLICKYTCGQQRMLKTHAWKHAGEVDCSYPIFEEENESAGL------- 240

  Fly   119 EFGPGGSSLELPAGKEVTQMDESSQNHIPLNTDDDDVDCSDFFMSEDDLAPPRKPGRPPRRTRPG 183
               |..:....|.|.| :.:.|.:::. |.:...|.|...|..:.|:.:.               
 Frog   241 ---PDSTVAHSPHGSE-SVLSEDTESR-PNSQTPDKVQVCDSLLLENTVK--------------- 285

  Fly   184 QVFKFKVSFIRS--NPRVLHLIQAYKEHPCLWNPSDEHYQDEPARSM--------AYEAIMERMD 238
                 ....|.|  ||..:.::..           |:...|....:|        |.:.|....:
 Frog   286 -----NTETINSTTNPETIEVVVV-----------DDSLSDADQDNMITNSLLSSAQKIISCSQN 334

  Fly   239 RKANVLFTVEELKKTLEQLHVQYTLALETKQRGKLVGLAARYFAKCEFLSVAPVVTPRENEEDND 303
            :|.:|...||.|....|.:          .|:..|:.         ..|:|...:.||:::    
 Frog   335 KKGHVNVIVERLPSAEETV----------SQKALLIS---------NDLAVKKKIVPRDSQ---- 376

  Fly   304 LTAIKLNFKEENLITTSFIETY-ANYPVLYNQALPDFGSIEIRADAFKRMAKEFQPVVKANETDV 367
                        ::....:|.| |:..|:.|:.:....|..|:...|....:.|.||.:...::.
 Frog   377 ------------IVCEGSVEVYHADKNVVENEEIIIGWSNTIKTGDFHESNENFPPVRRRTNSEC 429

  Fly   368 YIAVNKLRRWLYDAIRRLKSKELIQ------KCSKQEVQYLQMCSFL-PAKGSESQVLYCDYCDK 425
                  ||      :..|.::.|:.      :|.|..::.|.....| |..|.:           
 Frog   430 ------LR------LHSLAAEALVTMPISVVECPKSSLRILSKPDSLDPDTGQQ----------- 471

  Fly   426 RFHGDYNLRVH--IV----------------------KAHEVGDLPY----------LCSFCPRR 456
              .||.|...:  ||                      :..|:.:.|.          :......|
 Frog   472 --EGDRNFATYSKIVSSKMPEKVDGCGQTVINLKESQEGSELKEAPIKMGISMSLLKVIEKLRER 534

  Fly   457 FDRHVDMD--RHKLRSHFERKLKCQYCEKSFAVDTDLKVHTLIHTGERPHVCDICGKTFRLKLLL 519
            .|::...|  ..:||.:.:.:....:...|..|:      .|.| .|||:.|.:|..:...|..:
 Frog   535 TDQNATDDDILKELRDNAQTESTVDFASSSNVVE------YLPH-AERPYRCRLCHYSSDNKGYI 592

  Fly   520 DHHVNGVHLNIRPYSCNMCTKTFRKKFELANHIKGHLNIRDKKCEYCDATFYDHSSLSRHRRSHR 584
            ..|:. ||...:||.|.:|........:|.||:..|...|..:|::|..:||..:.|..|.|.||
 Frog   593 KQHLR-VHRQRQPYQCPICEHIADNSSDLENHMINHCKTRMYECKHCAESFYYKAQLRNHEREHR 656

  Fly   585 S 585
            |
 Frog   657 S 657

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1603NP_001260778.1 MADF_DNA_bdg 202..287 CDD:287510 13/93 (14%)
GT1 321..408 CDD:304916 18/94 (19%)
C2H2 Zn finger 420..441 CDD:275368 5/45 (11%)
COG5048 <424..583 CDD:227381 41/195 (21%)
C2H2 Zn finger 450..471 CDD:275368 5/23 (22%)
C2H2 Zn finger 478..498 CDD:275368 3/20 (15%)
zf-H2C2_2 490..513 CDD:290200 7/23 (30%)
C2H2 Zn finger 506..527 CDD:275368 5/21 (24%)
C2H2 Zn finger 535..555 CDD:275368 5/20 (25%)
C2H2 Zn finger 563..583 CDD:275368 7/20 (35%)
znf507XP_004913609.1 C2H2 Zn finger 579..599 CDD:275368 5/21 (24%)
C2H2 Zn finger 607..627 CDD:275368 5/20 (25%)
C2H2 Zn finger 635..655 CDD:275368 7/20 (35%)
C2H2 Zn finger 697..717 CDD:275368
C2H2 Zn finger 725..745 CDD:275368
C2H2 Zn finger 760..780 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.