DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1603 and znf142

Sequence 1:NP_001260778.1 Gene:CG1603 FlyBaseID:FBgn0033185 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_690036.3 Gene:znf142 ZFINID:ZDB-GENE-080512-2 Length:1535 Species:Danio rerio

Alignment Length:602 Identity:122/603 (20%)
Similarity:203/603 (34%) Gaps:206/603 (34%)


  Fly   124 GSSLELPAGKEVTQMDESSQNHI-PLNTDDDDVD-CSDFFMSEDDLA-PPRKPGRPPRRTRPGQV 185
            ||:.::...:...|.::  ::|. ..:.:|:||| .:|   ||.|.| ..|.|...||.:.|   
Zfish   928 GSAPKIYLAEMAGQFEQ--EDHFNDSDQEDEDVDGAND---SEGDSAVDERSPSSIPRFSCP--- 984

  Fly   186 FKFKVSFIRSNPRVLHLIQAYKEHP---CLWNPSDE----HYQDEPARSMAYEAIMERMDRKAN- 242
                     :.|.:.|..:|...|.   ||.....:    .:..:..:|:::..:..:.|:||. 
Zfish   985 ---------NCPFLCHQKRALASHEVKGCLKQGEIQCPHCSFVAKSDKSLSHHILSHKKDKKATK 1040

  Fly   243 -----------VLFTVEELKKTLEQLHVQYTLALETKQRGKLVGLAARYFAKCEFLSVAPVVTPR 296
                       ..||.::.:..::.:.|::.            |:...   :|.|.|.:.|...|
Zfish  1041 GKRSGNLQCDLCSFTCKQERCLMQHVAVKHE------------GVRPH---QCRFCSFSTVRRYR 1090

  Fly   297 ENEEDNDLTAIKLNFKE---ENLITTSFIETYANYPVLYNQALPD-----FGSI----------- 342
            ....::..|.:..:..|   :...|||.:.       |::|.:.|     |.|:           
Zfish  1091 LEAHESMHTGVGRHSCELCGQTFGTTSRLR-------LHHQRIHDKQATHFCSVCDYRAYNLNDI 1148

  Fly   343 ----------EIR-----ADAFKRMAKE---------------------------FQPVVKAN-E 364
                      |:|     .||  |.:.:                           .|..:||: :
Zfish  1149 NRHNLSCHTGELRYHCSQCDA--RFSSDGALKQHCHRVHSDANTLPCTQCSFTCRGQAALKAHMQ 1211

  Fly   365 TDVYIAVNKLRRWLYDAIRRLKSKELIQKCSKQEVQYLQMCSFLPAK---------------GSE 414
            :|.....|..:    |...:...|.:..||:        :|||...|               .:|
Zfish  1212 SDHSEKTNDPQ----DNPEKRSKKSITHKCT--------VCSFNTNKRLLLVQHMLDEHEDGPAE 1264

  Fly   415 SQVLYCDYC----------DK--RFHG--------------------DYNLRVHIVKAHEVGDLP 447
            .:.|.||.|          |:  |.||                    .:::|:|      .|:.|
Zfish  1265 EKTLKCDVCGFSCTHQMVFDQHIRSHGGTCLFKCTECEFSTRNKQKITWHIRIH------TGEKP 1323

  Fly   448 YLCSFC------PRRFDRHVDMDRHKLRSHF-ERKLKCQYCEKSFAVDTDLKVHTLIHTGERPHV 505
            |.|..|      |.|...|       :|.|. |||..|..|.........||.|...|||.:|:.
Zfish  1324 YRCEKCNYACADPSRLKYH-------MRIHMDERKYLCPECGYKCKWVNQLKYHMTKHTGAKPYA 1381

  Fly   506 CDICG-KTFRLKLLLDHHVNGVHLNIRPYSCNMCTKTFRKKFELANHIKGHLNIRDKKCEYCDAT 569
            |:.|. :|.|...|..|.... |.::|.:.|..|.|.|:.:|.|..|.:.|...|...|..|...
Zfish  1382 CEDCEYRTNRADALRIHRETR-HRDVRSFICEKCGKAFKTRFLLKTHQRKHSEARPYVCSVCQKA 1445

  Fly   570 FYDHSSLSRHRRSHRSE 586
            |...:.|..|..||.::
Zfish  1446 FRWPAGLRHHYLSHTNQ 1462

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1603NP_001260778.1 MADF_DNA_bdg 202..287 CDD:287510 14/104 (13%)
GT1 321..408 CDD:304916 22/146 (15%)
C2H2 Zn finger 420..441 CDD:275368 9/53 (17%)
COG5048 <424..583 CDD:227381 51/189 (27%)
C2H2 Zn finger 450..471 CDD:275368 6/27 (22%)
C2H2 Zn finger 478..498 CDD:275368 5/20 (25%)
zf-H2C2_2 490..513 CDD:290200 10/24 (42%)
C2H2 Zn finger 506..527 CDD:275368 6/22 (27%)
C2H2 Zn finger 535..555 CDD:275368 7/20 (35%)
C2H2 Zn finger 563..583 CDD:275368 6/20 (30%)
znf142XP_690036.3 COG5048 80..503 CDD:227381
C2H2 Zn finger 86..106 CDD:275368
C2H2 Zn finger 114..134 CDD:275368
C2H2 Zn finger 178..198 CDD:275368
C2H2 Zn finger 242..261 CDD:275368
C2H2 Zn finger 266..316 CDD:275368
C2H2 Zn finger 324..344 CDD:275368
C2H2 Zn finger 352..372 CDD:275368
C2H2 Zn finger 380..400 CDD:275368
C2H2 Zn finger 408..428 CDD:275368
C2H2 Zn finger 435..452 CDD:275368
C2H2 Zn finger 1078..1098 CDD:275370 5/20 (25%)
C2H2 Zn finger 1106..1127 CDD:275368 6/28 (21%)
C2H2 Zn finger 1135..1156 CDD:275368 1/21 (5%)
C2H2 Zn finger 1164..1185 CDD:275368 3/23 (13%)
C2H2 Zn finger 1193..1210 CDD:275368 3/17 (18%)
C2H2 Zn finger 1270..1290 CDD:275368 5/20 (25%)
C2H2 Zn finger 1298..1318 CDD:275368 1/20 (5%)
C2H2 Zn finger 1326..1346 CDD:275368 6/27 (22%)
C2H2 Zn finger 1354..1374 CDD:275368 5/20 (25%)
C2H2 Zn finger 1382..1403 CDD:275368 6/22 (27%)
C2H2 Zn finger 1411..1431 CDD:275368 7/20 (35%)
C2H2 Zn finger 1439..1459 CDD:275368 6/20 (30%)
C2H2 Zn finger 1467..1487 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.