DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1603 and si:ch211-113e8.10

Sequence 1:NP_001260778.1 Gene:CG1603 FlyBaseID:FBgn0033185 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_021326898.1 Gene:si:ch211-113e8.10 ZFINID:ZDB-GENE-090313-11 Length:792 Species:Danio rerio

Alignment Length:589 Identity:117/590 (20%)
Similarity:198/590 (34%) Gaps:168/590 (28%)


  Fly    51 RINEIKEDTEELYSVVDAADPAIAYGP--------DEFF--EVI--ENSNG-------------- 89
            :::..||:||...::..:|..:.|..|        |..|  ||.  ..:||              
Zfish     4 QLSSNKEETESETAIEKSAGQSTASSPCRASRGRGDGCFNTEVTCPPETNGAATSATGSGRVLRD 68

  Fly    90 -----VDQWMEAD-SKDI-QYEEDAT------AWSAATNNSWEFGPGGSSLELPAGKEVTQMDES 141
                 :..|.:.| |:|: :...||:      |.......|    |..::....|||:       
Zfish    69 RSTRTIPVWRQTDISEDLAEVSRDASGNRRRKAKCPRRRKS----PAAAAASSDAGKD------- 122

  Fly   142 SQNHIPLNTDDDDVDCSDFFMSEDDLAPPR---------KPGRPPRRTRPGQVFK----FKVSFI 193
                     ...|.|..|.|....|....|         :.|....|..|..|||    ..|.::
Zfish   123 ---------SGGDCDLLDEFEENKDALVNRAARGRRVQVRSGARTCRGSPRTVFKSEPEMDVDYV 178

  Fly   194 RSNPRVLHL---------------IQAYKEHPCLWNPSDEHYQDEPARSMAYEAIMERMDRKANV 243
            .:|..|...               :...:|.|.:.:|.||:|:.:..|..:    :.|.|:.:.:
Zfish   179 EANKAVEKTGTSVEKKEEESMDDDVVEEEECPFVDDPKDENYRPQSNRIPS----VRRQDKHSTM 239

  Fly   244 LFTVEELKKTLEQLHVQYTLALETKQRGKLVGLAARYFAKCEFLSVAPVVTPRENEED------- 301
            ..:..:..:......:                                   |.|.||.       
Zfish   240 TDSSSDSDEAESSSQI-----------------------------------PHEGEETISSDEDV 269

  Fly   302 ------NDLTAIKLNFKEENLITTSFIETYANYPVLYNQALPDFGSIEIRADAFKRMAKEFQPVV 360
                  ||.:....:|.:......:.::...:.|.:  |..|.....||:.:..:...::.:..|
Zfish   270 PFRDDLNDQSYDPKDFSKSKRRPHTRLKEKKDKPTV--QETPTEQETEIKTEGGETTEEQTRAEV 332

  Fly   361 KANETDVYIAVNKLRRWLYDAIRRLKSKELIQKCSKQEVQYLQMCSFLPAKGSESQVLYCDYCDK 425
               |........:.||...|     ||..|.::..|..|||:: |..   :|..:.:.:..|.. 
Zfish   333 ---EEGAEPPRKRGRRRKDD-----KSPRLPKRRKKPPVQYVR-CEM---EGCGTVLAHPRYLQ- 384

  Fly   426 RFHGDYNLRVHIVKAHEVGDLPYLCSF--CPRRFDRHVDMDRHKLRSHFERKLKCQYCEKSFAVD 488
                      |.:|...:....|:|..  |.|.|.....:.||......:|...|::|.::|...
Zfish   385 ----------HHIKYQHLMKKKYVCPHPTCGRLFRLQKQLLRHAKHHTDQRDYICEFCARAFKSS 439

  Fly   489 TDLKVHTLIHTGERPHVCDICGKTFRLKLLLDHHVNGVHLNIR-PYSCNMCTKTFRKKFELANH- 551
            .:|.||.:|||||:|..|:|||.|.|.|..|:.|:.....:.. .:||::|.|.|.||..:..| 
Zfish   440 HNLAVHRMIHTGEKPLQCEICGFTCRQKASLNWHMKKHDADATYQFSCSICGKKFEKKDSVVAHK 504

  Fly   552 IKGH 555
            .|.|
Zfish   505 AKSH 508

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1603NP_001260778.1 MADF_DNA_bdg 202..287 CDD:287510 9/100 (9%)
GT1 321..408 CDD:304916 18/87 (21%)
C2H2 Zn finger 420..441 CDD:275368 3/21 (14%)
COG5048 <424..583 CDD:227381 41/137 (30%)
C2H2 Zn finger 450..471 CDD:275368 6/23 (26%)
C2H2 Zn finger 478..498 CDD:275368 7/20 (35%)
zf-H2C2_2 490..513 CDD:290200 14/23 (61%)
C2H2 Zn finger 506..527 CDD:275368 9/21 (43%)
C2H2 Zn finger 535..555 CDD:275368 8/21 (38%)
C2H2 Zn finger 563..583 CDD:275368
si:ch211-113e8.10XP_021326898.1 zf-C2H2_8 368..445 CDD:318181 18/91 (20%)
C2H2 Zn finger 402..421 CDD:275368 5/19 (26%)
C2H2 Zn finger 429..449 CDD:275368 7/20 (35%)
zf-C2H2 456..477 CDD:306579 9/21 (43%)
C2H2 Zn finger 457..477 CDD:275368 9/20 (45%)
C2H2 Zn finger 487..503 CDD:275368 6/16 (38%)
Amelogenin <633..>716 CDD:330537
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.