DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1603 and E(var)3-9

Sequence 1:NP_001260778.1 Gene:CG1603 FlyBaseID:FBgn0033185 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_649852.2 Gene:E(var)3-9 FlyBaseID:FBgn0260243 Length:588 Species:Drosophila melanogaster

Alignment Length:115 Identity:36/116 (31%)
Similarity:48/116 (41%) Gaps:11/116 (9%)


  Fly   447 PYLCSFCPRRFDRHVDMD---RHKLRSHFERKLKCQYCEKSF--AVDTDLKVHTLIHTGERPHVC 506
            |.:|  |...|....|.|   .|..|:|..:..:|..|.|.|  |.::.:|.|...|..:|...|
  Fly   249 PVVC--CKLCFYESPDQDAHMEHMRRTHLLKDWECHICGKKFTNAQESRIKFHIKYHKLQRHVKC 311

  Fly   507 DICGKTFRLKLLLDHHVNGVHLNIRPYSCNMCTKTFRKKFELANHIKGHL 556
            .:||.....|..|..|...||:..:   |..|.||. |...|..|:|.||
  Fly   312 PVCGFICSSKETLKEHKQAVHVRTK---CTYCGKTV-KNATLHAHLKKHL 357

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1603NP_001260778.1 MADF_DNA_bdg 202..287 CDD:287510
GT1 321..408 CDD:304916
C2H2 Zn finger 420..441 CDD:275368
COG5048 <424..583 CDD:227381 36/116 (31%)
C2H2 Zn finger 450..471 CDD:275368 7/24 (29%)
C2H2 Zn finger 478..498 CDD:275368 7/22 (32%)
zf-H2C2_2 490..513 CDD:290200 7/23 (30%)
C2H2 Zn finger 506..527 CDD:275368 7/21 (33%)
C2H2 Zn finger 535..555 CDD:275368 8/20 (40%)
C2H2 Zn finger 563..583 CDD:275368
E(var)3-9NP_649852.2 zf-AD 18..102 CDD:285071
zf-C2H2_2 253..>334 CDD:289522 24/81 (30%)
C2H2 Zn finger 253..274 CDD:275368 6/21 (29%)
C2H2 Zn finger 281..303 CDD:275368 7/22 (32%)
PHA00732 310..>358 CDD:177300 18/53 (34%)
C2H2 Zn finger 311..332 CDD:275368 7/21 (33%)
C2H2 Zn finger 337..356 CDD:275368 8/20 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24403
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.