DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1603 and scrt

Sequence 1:NP_001260778.1 Gene:CG1603 FlyBaseID:FBgn0033185 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001261390.1 Gene:scrt FlyBaseID:FBgn0004880 Length:653 Species:Drosophila melanogaster

Alignment Length:141 Identity:45/142 (32%)
Similarity:68/142 (48%) Gaps:12/142 (8%)


  Fly   448 YLCSFCPRRFDRHVDMDRHKLRSHFERKL------KCQYCEKSFAVDTDLKVHTLIHTGERPHVC 506
            |.||.|.:::....::.||| ::|  |.|      ||..|.|::.....|.:|.|.|  :..|.|
  Fly   467 YTCSECGKQYATSSNLSRHK-QTH--RSLDSQSAKKCHTCGKAYVSMPALAMHLLTH--KLSHSC 526

  Fly   507 DICGKTFRLKLLLDHHVNGVHLNIRPYSCNMCTKTFRKKFELANHIKGHLNIRDKKCEYCDATFY 571
            .:|||.|....||..|:.. |...:||.|..|.|.|..:..|..|::.|...::.:|:.|..||.
  Fly   527 GVCGKLFSRPWLLQGHLRS-HTGEKPYGCAHCGKAFADRSNLRAHMQTHSVDKNFECKRCHKTFA 590

  Fly   572 DHSSLSRHRRS 582
            ..|.|::|..|
  Fly   591 LKSYLNKHLES 601

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1603NP_001260778.1 MADF_DNA_bdg 202..287 CDD:287510
GT1 321..408 CDD:304916
C2H2 Zn finger 420..441 CDD:275368
COG5048 <424..583 CDD:227381 45/142 (32%)
C2H2 Zn finger 450..471 CDD:275368 6/21 (29%)
C2H2 Zn finger 478..498 CDD:275368 6/20 (30%)
zf-H2C2_2 490..513 CDD:290200 9/23 (39%)
C2H2 Zn finger 506..527 CDD:275368 8/21 (38%)
C2H2 Zn finger 535..555 CDD:275368 6/20 (30%)
C2H2 Zn finger 563..583 CDD:275368 8/21 (38%)
scrtNP_001261390.1 zf-C2H2 467..489 CDD:278523 7/23 (30%)
C2H2 Zn finger 469..489 CDD:275370 6/21 (29%)
C2H2 Zn finger 500..520 CDD:275368 6/20 (30%)
COG5048 520..>617 CDD:227381 28/86 (33%)
C2H2 Zn finger 526..546 CDD:275368 8/21 (38%)
zf-H2C2_2 539..562 CDD:290200 9/24 (38%)
C2H2 Zn finger 554..574 CDD:275368 6/20 (30%)
zf-C2H2 554..574 CDD:278523 6/20 (30%)
zf-H2C2_2 566..590 CDD:290200 7/24 (29%)
C2H2 Zn finger 582..599 CDD:275368 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C123609970
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.