DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1603 and Zfp52

Sequence 1:NP_001260778.1 Gene:CG1603 FlyBaseID:FBgn0033185 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001014180.1 Gene:Zfp52 RGDID:1359149 Length:755 Species:Rattus norvegicus

Alignment Length:662 Identity:139/663 (21%)
Similarity:237/663 (36%) Gaps:183/663 (28%)


  Fly    22 YCSIESELKDWELFIVHVKSAHYCEDEDVRINEIKEDTEELYSVVDAADPAIAYGPD-----EFF 81
            ||..|:..:       |||:    |.|..:.||:.|               :..||.     :..
  Rat    87 YCICETVHQ-------HVKT----EKESCQCNELGE---------------MLRGPSNCALYKRS 125

  Fly    82 EVIENSNGV----DQWMEADSKD-IQYEEDATAWSAATNNSWEFGPGGSSLELPAG-KEVTQMDE 140
            :.||.||..    |:....||.: .|:....|.....|:.:.|     .|..|.:. :|..::..
  Rat   126 DTIETSNNCRCCKDRGASVDSSNPDQHTSTHTGEEPCTSKNCE-----KSFSLCSNIREDQRLYT 185

  Fly   141 SSQNHIPLNTDDDDVDCSDFFMSEDDLAPPR-KPGRPPRRTRPGQVFKFKVSFIRSNPRVLHLIQ 204
            :.:.|     ..|:.|  |.|.|...|.... ..|..|.:..|.:.:....|.:..:.|:....:
  Rat   186 AKKEH-----KQDEYD--DRFSSTYSLMQQTVDMGEKPHQCGPCRKYINTTSSLSLHQRIHTGEK 243

  Fly   205 AYKEHPC-----LWNP---------SDEHYQDEPARSMAYEAIMERMDRKANV---LFTVEELKK 252
            .||.:.|     .|:.         |::.|:.:..|....:....:..::.:.   .:..:|..:
  Rat   244 PYKCNICEKSFNQWSRLKTHQILHISEKQYKCKEGRMSFVQVFAHKSHQRRHTGEKPYKCKECDR 308

  Fly   253 TL---------EQLH---VQYTLALETKQRGKLVGLAARYFAKCEFLS----VAPVVTPRENEED 301
            :.         :::|   |.|    |.|:.||.       |::...|.    :..|..|...||.
  Rat   309 SFAHCASLRWHQKIHSPEVHY----ECKECGKA-------FSELSHLKMHYRIHTVEKPYRYEEC 362

  Fly   302 NDLTAIKLNFKEENLITT-----------------SFIETYANYPVLYNQALPDFGSIEIRADAF 349
            :..:.:....|....|.|                 |::.||                        
  Rat   363 DTSSTVNSTLKNHQKIHTREKPYRYRECDKSITKCSYLRTY------------------------ 403

  Fly   350 KRMAKEFQPVVKANETD-VYIAVNKLRRWLYDAIRRLKSKELIQKCSKQEVQYLQMCSFLPAKGS 413
            :|:....:| .:..|.| .:...:.||:.     :::.:.|....|...:..:|::.|.     .
  Rat   404 QRVHTGMRP-YRCTECDKSFTTYSNLRQH-----QKIHTGEKPPNCKGSDKSFLRISSV-----R 457

  Fly   414 ESQVLY-------CDYCDKRFHGDYNLRVHIVKAHEVGDLPYLCSFCPRRFDRHVDMDRHKLRSH 471
            :.|.::       |..|.:.|....||||| .:.| .|:.||.|..|.:.|....::..|:....
  Rat   458 KHQKIHAGERRYGCKECSRSFTWFSNLRVH-QRVH-TGERPYRCKDCDKSFTTGSNLRVHQKIHT 520

  Fly   472 FERKLKCQYCEKSFAVDTDLKVHTLIHTGERPHVCDICGKTF-RLKLLLDH---HV--------- 523
            .|:..||:.|:.||...::|:.|..|||||:|:.|..|.|:| |...|.||   |.         
  Rat   521 GEKPYKCKDCDISFLWISNLRTHQKIHTGEKPYKCQECKKSFTRCSYLRDHQKIHTGEKLYKCKD 585

  Fly   524 --------------NGVHLNIRPYSCNMCTKTFRKKFELANHIKGHLNIRDKKCEYCDATFYDHS 574
                          ..:|...:||.|..|.|:|.:...|.:|.|.|...:..||:.||.:|...|
  Rat   586 CNVSFMWISSLRRHQKIHTGEKPYKCRECEKSFTQCSTLRDHQKIHTGEKPYKCKDCDISFLWIS 650

  Fly   575 SLSRHRRSHRSE 586
            ||.||::.|..|
  Rat   651 SLRRHQKIHTGE 662

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1603NP_001260778.1 MADF_DNA_bdg 202..287 CDD:287510 16/114 (14%)
GT1 321..408 CDD:304916 12/88 (14%)
C2H2 Zn finger 420..441 CDD:275368 8/21 (38%)
COG5048 <424..583 CDD:227381 58/186 (31%)
C2H2 Zn finger 450..471 CDD:275368 4/21 (19%)
C2H2 Zn finger 478..498 CDD:275368 7/20 (35%)
zf-H2C2_2 490..513 CDD:290200 11/23 (48%)
C2H2 Zn finger 506..527 CDD:275368 9/48 (19%)
C2H2 Zn finger 535..555 CDD:275368 7/20 (35%)
C2H2 Zn finger 563..583 CDD:275368 9/20 (45%)
Zfp52NP_001014180.1 KRAB 45..>85 CDD:214630
KRAB 45..84 CDD:279668
C2H2 Zn finger 219..239 CDD:275368 3/20 (15%)
zf-H2C2_2 231..256 CDD:290200 4/25 (16%)
C2H2 Zn finger 247..295 CDD:275368 5/48 (10%)
zf-H2C2_2 289..312 CDD:290200 1/23 (4%)
C2H2 Zn finger 303..323 CDD:275368 1/20 (5%)
COG5048 329..702 CDD:227381 90/383 (23%)
C2H2 Zn finger 331..351 CDD:275368 5/27 (19%)
C2H2 Zn finger 359..379 CDD:275368 4/20 (20%)
C2H2 Zn finger 388..407 CDD:275368 4/43 (9%)
C2H2 Zn finger 415..435 CDD:275368 4/25 (16%)
C2H2 Zn finger 443..463 CDD:275370 4/25 (16%)
C2H2 Zn finger 471..491 CDD:275368 8/21 (38%)
zf-H2C2_2 483..508 CDD:290200 12/27 (44%)
C2H2 Zn finger 499..519 CDD:275368 4/20 (20%)
zf-H2C2_2 511..534 CDD:290200 6/23 (26%)
C2H2 Zn finger 527..547 CDD:275368 7/20 (35%)
zf-H2C2_2 539..564 CDD:290200 12/25 (48%)
C2H2 Zn finger 555..575 CDD:275368 8/20 (40%)
C2H2 Zn finger 583..603 CDD:275368 0/20 (0%)
zf-H2C2_2 595..620 CDD:290200 7/25 (28%)
C2H2 Zn finger 611..631 CDD:275368 7/20 (35%)
C2H2 Zn finger 639..659 CDD:275368 9/20 (45%)
zf-H2C2_2 651..674 CDD:290200 6/13 (46%)
C2H2 Zn finger 667..687 CDD:275368
zf-H2C2_2 679..704 CDD:290200
C2H2 Zn finger 695..715 CDD:275368
zf-H2C2_2 707..730 CDD:290200
C2H2 Zn finger 723..743 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.