DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1603 and esg

Sequence 1:NP_001260778.1 Gene:CG1603 FlyBaseID:FBgn0033185 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_476600.1 Gene:esg FlyBaseID:FBgn0001981 Length:470 Species:Drosophila melanogaster

Alignment Length:212 Identity:54/213 (25%)
Similarity:87/213 (41%) Gaps:36/213 (17%)


  Fly   398 EVQYLQMCSFLPAKGSESQVLYCDYCDKRFHGDYNLRVHIVK-----AHEVGDLP---------- 447
            |..|..|.|..| :.|.|..|..|...|  |.:.||.::..:     |.:.||:.          
  Fly   239 ENSYYSMRSMTP-ESSCSSSLPEDLSLK--HKNLNLNLNTSQPGEQAAAKTGDMSPETMPNASAK 300

  Fly   448 --------YLCSFCPRRFDRHVDMDRHKL-------RSHFERKLKCQYCEKSFAVDTDLKVHTLI 497
                    |.|..|.:.:.....:.:|:.       .:..::...|:.|:|::.....||:|...
  Fly   301 KDKNQPPRYQCPDCQKSYSTFSGLTKHQQFHCPAAEGNQVKKSFSCKDCDKTYVSLGALKMHIRT 365

  Fly   498 HTGERPHVCDICGKTFRLKLLLDHHVNGVHLNIRPYSCNMCTKTFRKKFELANHIKGHLNIRDKK 562
            ||  .|..|::|||.|....||..|:. .|...:|:||..|.:.|..:..|..|::.|.:|:...
  Fly   366 HT--LPCKCNLCGKAFSRPWLLQGHIR-THTGEKPFSCQHCHRAFADRSNLRAHLQTHSDIKKYS 427

  Fly   563 CEYCDATFYDHSSLSRH 579
            |..|..||...|.|::|
  Fly   428 CTSCSKTFSRMSLLTKH 444

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1603NP_001260778.1 MADF_DNA_bdg 202..287 CDD:287510
GT1 321..408 CDD:304916 4/10 (40%)
C2H2 Zn finger 420..441 CDD:275368 6/26 (23%)
COG5048 <424..583 CDD:227381 45/187 (24%)
C2H2 Zn finger 450..471 CDD:275368 3/28 (11%)
C2H2 Zn finger 478..498 CDD:275368 6/20 (30%)
zf-H2C2_2 490..513 CDD:290200 10/23 (43%)
C2H2 Zn finger 506..527 CDD:275368 8/21 (38%)
C2H2 Zn finger 535..555 CDD:275368 5/20 (25%)
C2H2 Zn finger 563..583 CDD:275368 7/18 (39%)
esgNP_476600.1 zf-C2H2 309..331 CDD:278523 4/22 (18%)
C2H2 Zn finger 311..331 CDD:275370 3/20 (15%)
zf-C2H2 344..366 CDD:278523 6/22 (27%)
C2H2 Zn finger 346..366 CDD:275368 6/20 (30%)
zf-C2H2 370..392 CDD:278523 8/23 (35%)
C2H2 Zn finger 372..392 CDD:275368 8/21 (38%)
zf-H2C2_2 385..408 CDD:290200 8/24 (33%)
zf-C2H2 398..420 CDD:278523 6/22 (27%)
C2H2 Zn finger 400..420 CDD:275368 5/20 (25%)
C2H2 Zn finger 428..444 CDD:275368 6/16 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C123612127
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.