DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1603 and Zfp335

Sequence 1:NP_001260778.1 Gene:CG1603 FlyBaseID:FBgn0033185 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_017174546.1 Gene:Zfp335 MGIID:2682313 Length:1373 Species:Mus musculus

Alignment Length:656 Identity:128/657 (19%)
Similarity:217/657 (33%) Gaps:236/657 (36%)


  Fly    47 DEDVRINEIKEDTEELYSVVDAADPAIAYGPDEFFEVIENSNGVDQWMEADSKDIQYEEDATAWS 111
            |..:.:::....:.:|.|.:|              ::||::.|.|.        ||        |
Mouse   113 DPSMLVSDCTASSSDLGSAID--------------KIIESTIGPDL--------IQ--------S 147

  Fly   112 AATNNSWEFGPGGSSLELPAGKEVTQMDESSQNHIPLNTDDDDVDCSDFFMSEDDLAPPRKPGRP 176
            ..|..|.|.|          |.|.||       ::.|...||....:. .||...||        
Mouse   148 CITVTSGEEG----------GAETTQ-------YLILQGPDDGAPMAS-SMSTSTLA-------- 186

  Fly   177 PRRTRPGQVFKFKVSFIRSNPRVLHLIQAYKEHP-----CLWNPSDEHYQDEPARSMAYE---AI 233
                                 ..|..|:|..:.|     ||..|  |..|.:|: |:|.:   .:
Mouse   187 ---------------------NSLAAIEALADGPTSTSACLEPP--EEPQGDPS-SVAQQPPAPV 227

  Fly   234 MERMDRKANVLFTVEELKKTLEQLHVQYTLALETKQRGKLVGLAARYFAKCEF----LSVAPVVT 294
            .|.:|        ::.|:..:|.:.||.......:.|........|:..:..|    |:.|...|
Mouse   228 TEELD--------LQSLEAMMEVVVVQQFKCKMCQYRSSTKATLLRHMRERHFRPAALAAAAAAT 284

  Fly   295 --------------------PRENEEDNDLT-AIKLNFKEEN----------------------- 315
                                |.|.|||:|:. |..::..||:                       
Mouse   285 GKRGRVRKWGTSTKTTEEDRPEEEEEDDDIVDAGAIDDLEEDSDYNPAEDEPRGRQLRLQRPTPS 349

  Fly   316 ---------------LITTSFIETYANYPVLYNQAL---PDFGSIEI-RADAFKRMAKEFQPVVK 361
                           .:.||.:......|::.:|:.   |:...:|. .:...:.:.|..:.:|:
Mouse   350 TPRPRRRPGRPRKLPRLETSDLHDGVGQPLVSSQSTQSPPELQDLEAPSSSGLRALGKVGRGLVE 414

  Fly   362 A--NETDVYIAV-----------------------NKLRRWLYDAIRRLKSKELIQKCSKQEVQY 401
            :  :::|...|.                       .|.|::.|.:     .|.|::       .|
Mouse   415 SGVSQSDAENAAPSCQDEADAPPRRRGRPSRRFLGKKYRKYYYKS-----PKPLLR-------PY 467

  Fly   402 LQMCSFLPAKGSESQVLYCDYCDKRFHGDYNLRVHIVKAHEVGDLPYL--CSFCPRRFDRHVDMD 464
            |                 |..|..||....:||.| |.:||.|| |.|  |..|..|..|...:.
Mouse   468 L-----------------CRICGSRFLSHEDLRFH-VNSHEAGD-PQLFRCLQCSYRSRRWSSLK 513

  Fly   465 RHKLRSHFERKLKCQYCEKSFAVDTDLKVHTLIHTGER-------PHV----CDICGKTFRLKLL 518
            .|.......:..||..|..:.....|:..|..:|:.:|       |.:    |.:||:.:.::..
Mouse   514 EHMFNHVGSKPYKCDECSYTSVYRKDVIRHAAVHSQDRKKRPDPTPKLSSFPCPVCGRVYPMQKR 578

  Fly   519 LDHHVNGVHLNIRPYSCNMCTKTFRKKFELANHIKGHLNI---RDKKCEYCDATFYDHSSLSRHR 580
            |..|:. .|...:|:.|:.|.|:|:|::....|:..|:..   |..|||:|:....|..:|..|:
Mouse   579 LTQHMK-THSTEKPHMCDKCGKSFKKRYTFKMHLLTHIQAVANRRFKCEFCEFVCEDKKALLNHQ 642

  Fly   581 RSHRSE 586
            .||.|:
Mouse   643 LSHVSD 648

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1603NP_001260778.1 MADF_DNA_bdg 202..287 CDD:287510 20/97 (21%)
GT1 321..408 CDD:304916 15/116 (13%)
C2H2 Zn finger 420..441 CDD:275368 8/21 (38%)
COG5048 <424..583 CDD:227381 48/175 (27%)
C2H2 Zn finger 450..471 CDD:275368 5/21 (24%)
C2H2 Zn finger 478..498 CDD:275368 4/20 (20%)
zf-H2C2_2 490..513 CDD:290200 8/34 (24%)
C2H2 Zn finger 506..527 CDD:275368 5/21 (24%)
C2H2 Zn finger 535..555 CDD:275368 6/20 (30%)
C2H2 Zn finger 563..583 CDD:275368 7/20 (35%)
Zfp335XP_017174546.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.