DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1603 and Zfp142

Sequence 1:NP_001260778.1 Gene:CG1603 FlyBaseID:FBgn0033185 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_008765462.1 Gene:Zfp142 RGDID:1309648 Length:1841 Species:Rattus norvegicus

Alignment Length:512 Identity:117/513 (23%)
Similarity:184/513 (36%) Gaps:105/513 (20%)


  Fly   138 MDESSQNHIPLNTDDDDVDCSDFFMSEDDLAPPRKPGRPPRRTRPGQVFKFKVSFIRSNPRVLHL 202
            |:...|.|.|.:..    .||  ||..:     .|..|..:|:. |...:.::|.::..|. ..|
  Rat   222 MELHRQAHYPFHCS----HCS--FMGSN-----VKLFRQHQRSH-GASTRGELSAVQGLPS-QEL 273

  Fly   203 IQAYKEHPCLWNPSDEHYQDEPARSMAYEAIMERMDRKA-------------------NVLFTVE 248
            :.|.|..|....||:|.....|.:..|.|..:|..:..|                   :|....|
  Rat   274 LPAAKLPPGDREPSEEAGAPLPGQESAEEEDVEEEENVAQKDSQKVLDKSQGAQQLEGHVASGTE 338

  Fly   249 ELKKT----------------LEQLHVQY---TLALETKQ-----RGKL-------VGLAARYFA 282
            .|.||                :|.||:.:   :|.....|     :.||       :|..|....
  Rat   339 SLFKTHMCPECKRCFKKRTHLVEHLHLHFPDPSLQCPNCQKFFTSKSKLKTHLLRELGEKAHRCP 403

  Fly   283 KCEFLSVAPVVTPRENEEDNDLTAIKLNFKEENLITTSFIETYANYPVL-----YNQALPDFGSI 342
            .|.:.:|          |.|.|.....:..|:  |:..:.:||| .||.     .:|||.:....
  Rat   404 LCHYSAV----------ERNALNRHMASMHED--ISNFYSDTYA-CPVCREEFRLSQALKEHLKS 455

  Fly   343 EIRADAFKRMAKEFQPVVKANETDVYIAVNKLRRWLYDAIRRLKSKELIQ--KCSKQEVQYLQMC 405
            ...|     .|.|..|:....|..:|:|.::..     .::.||....::  :|.......|   
  Rat   456 HTAA-----AAAEPLPLHCFQEGCLYVAPDRKA-----FLKHLKETHGVRAVECRHHSCPML--- 507

  Fly   406 SFLPAKGSESQ-----VLYCDYCDKRFHGDYNLRVHIVKAHEVGDLPYLCSFCPRRFDRHVDMDR 465
             |..|:..|:.     ..:|.:||......:..|.|..:.|. |.....|:|||......|....
  Rat   508 -FATAEAMEAHHKSHYAFHCPHCDFACSNKHLFRKHKKQGHP-GSEELRCTFCPFATFNPVAYQD 570

  Fly   466 HKLRSHFERKL-KCQYCEKSFAVDTDLKVHTLIHTGERPHVCDICGKTFRLKLLLDHHVNGVHLN 529
            |..:.|...|: :|..|..:.|....|..|.|:||||:||.|::|..|.|....|..|:. .|.|
  Rat   571 HVGKMHAHEKIHQCSECNFATAHKRVLIRHMLLHTGEKPHKCELCDFTCRDVSYLSKHML-THSN 634

  Fly   530 IRPYSCNMCTKTFRKKFELANHIKGHLNIRDKKCEYCDATFYDHSSLSRHRRSHRSE 586
            .:.|.|..|....:.|..|:.|::.|......:|..|....:....||.|:..|:.:
  Rat   635 TKDYMCTECGYVTKWKHYLSVHMRKHAGDLRYQCNQCSYRCHRADQLSSHKLRHQGK 691

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1603NP_001260778.1 MADF_DNA_bdg 202..287 CDD:287510 27/135 (20%)
GT1 321..408 CDD:304916 20/94 (21%)
C2H2 Zn finger 420..441 CDD:275368 5/21 (24%)
COG5048 <424..583 CDD:227381 45/160 (28%)
C2H2 Zn finger 450..471 CDD:275368 6/21 (29%)
C2H2 Zn finger 478..498 CDD:275368 6/20 (30%)
zf-H2C2_2 490..513 CDD:290200 12/23 (52%)
C2H2 Zn finger 506..527 CDD:275368 6/21 (29%)
C2H2 Zn finger 535..555 CDD:275368 5/20 (25%)
C2H2 Zn finger 563..583 CDD:275368 5/20 (25%)
Zfp142XP_008765462.1 COG5048 321..762 CDD:227381 91/401 (23%)
C2H2 Zn finger 346..366 CDD:275368 3/20 (15%)
C2H2 Zn finger 374..394 CDD:275368 3/20 (15%)
C2H2 Zn finger 402..419 CDD:275368 5/27 (19%)
C2H2 Zn finger 436..456 CDD:275368 5/20 (25%)
C2H2 Zn finger 502..521 CDD:275368 4/23 (17%)
C2H2 Zn finger 526..547 CDD:275368 5/21 (24%)
C2H2 Zn finger 555..576 CDD:275368 6/21 (29%)
C2H2 Zn finger 584..604 CDD:275368 6/20 (30%)
C2H2 Zn finger 612..632 CDD:275368 6/21 (29%)
C2H2 Zn finger 640..660 CDD:275368 5/20 (25%)
C2H2 Zn finger 668..688 CDD:275368 5/20 (25%)
C2H2 Zn finger 695..712 CDD:275368
C2H2 Zn finger 1266..1295 CDD:275368
C2H2 Zn finger 1332..1353 CDD:275368
C2H2 Zn finger 1361..1381 CDD:275368
C2H2 Zn finger 1389..1410 CDD:275368
C2H2 Zn finger 1447..1468 CDD:275368
C2H2 Zn finger 1488..1506 CDD:275368
C2H2 Zn finger 1514..1534 CDD:275368
C2H2 Zn finger 1580..1600 CDD:275368
C2H2 Zn finger 1608..1628 CDD:275368
C2H2 Zn finger 1636..1656 CDD:275368
C2H2 Zn finger 1664..1684 CDD:275368
C2H2 Zn finger 1692..1713 CDD:275368
C2H2 Zn finger 1721..1741 CDD:275368
C2H2 Zn finger 1749..1769 CDD:275368
C2H2 Zn finger 1777..1797 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24403
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.