DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1603 and Zfp513

Sequence 1:NP_001260778.1 Gene:CG1603 FlyBaseID:FBgn0033185 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001012110.1 Gene:Zfp513 RGDID:1310456 Length:541 Species:Rattus norvegicus

Alignment Length:607 Identity:115/608 (19%)
Similarity:186/608 (31%) Gaps:180/608 (30%)


  Fly    40 KSAHYCEDEDVRINEIKEDTEELYSVVDAADPAIAYGPDEFFEVIENSNGVDQWMEAD---SKDI 101
            |.:|   .:.|:...:|.|||:.:.          .||....            :|:|   .:|:
  Rat     5 KQSH---PQPVKCEGVKVDTEDSFD----------EGPGALV------------LESDLLLGQDL 44

  Fly   102 QYEEDATAWSAATNNSWEFGPGGSSLELPAGKEVTQMDESSQNHIPLNTDDDDVDCSDFFMSEDD 166
            ::||:         ...|.|.|.:...:...::.....:.::..:|....||:........:|.:
  Rat    45 EFEEE---------EEEEEGDGHNDQLMGFERDSEGDSQGARPGLPYGLSDDESGGGRALSAESE 100

  Fly   167 L-APPRKPGRPPRRTRPGQVFKFKVSFIRSNP---------------------RVLHLIQAYKEH 209
            : .|.|.||. .|..|||...:.........|                     |:...:..|..|
  Rat   101 VEEPARGPGE-ARGERPGPACQLCGGPTGEGPCCGAGGPGGGPPLPPRLLYSCRLCAFVSHYSSH 164

  Fly   210 PCLWNPSDEHYQDEPAR------SMAYEAIMERMDRKANVLFTVEELKKTLEQLHVQYTLA---- 264
              |......|..::|.|      :.|....:.|..|       ....:|.....|..:..:    
  Rat   165 --LKRHMQTHSGEKPFRCGRCPYASAQLVNLTRHTR-------THTGEKPYRCPHCPFACSSLGN 220

  Fly   265 LETKQRGKLVGLAARYFAKCEFLSVAPVVT------------PRENEEDNDLTAIKLNFKEENLI 317
            |...||.. .|........|.|...||..|            ||.:|:...|..:.|:.....  
  Rat   221 LRRHQRTH-TGPPTPPCPTCGFRCCAPRPTRPPSPTEQEGTMPRRSEDALILPDLSLHVPPGG-- 282

  Fly   318 TTSFIETYANYPVLYNQALPDFGSIEIRADAFKRMAKEFQPVVKANETDVYIAVNKLRRWLYDAI 382
             |||              |||.|.:....:.......|..|.:             |..|     
  Rat   283 -TSF--------------LPDCGQLRGEGEGLCGTGSEPLPEL-------------LFPW----- 314

  Fly   383 RRLKSKELIQKCSKQEVQYLQMCSFLPAKGSESQVLYCDYCDKRFHGDYNLRVHIVKAHEVG--- 444
                   ..:.|. ||::        ..:||......|..|              ::....|   
  Rat   315 -------TCRGCG-QELE--------EGEGSRLGTAMCGRC--------------MRGESGGGGS 349

  Fly   445 -------DLPYLCSFCPRRFDRHV--DMDRHKLRSHFERKLKCQYCEKSFAVDTDLKVHTLIHTG 500
                   |..:.||.||  |..|.  .:.||......|:..:|..|..:.|...:||.|..:|||
  Rat   350 GGPQGPSDKGFACSLCP--FATHYPNHLARHMKTHSGEKPFRCARCPYASAHLDNLKRHQRVHTG 412

  Fly   501 ERPHVCDI----CGKTFRLKLLLDHHVNGVHLNIRPYSCNMCTKTFRKKFELANHIKGHLNIRDK 561
            |:|:.|.:    ||....||    .| ..:|...:|:.|::|..:..:...|..|:..|...:..
  Rat   413 EKPYKCPLCPYACGNLANLK----RH-GRIHSGDKPFRCSLCNYSCNQSMNLKRHMLRHTGEKPF 472

  Fly   562 KCEYCDATFYDHSSLSRHRRSH 583
            :|..|..|.....:..||::.|
  Rat   473 RCATCAYTTGHWDNYKRHQKVH 494

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1603NP_001260778.1 MADF_DNA_bdg 202..287 CDD:287510 17/95 (18%)
GT1 321..408 CDD:304916 12/87 (14%)
C2H2 Zn finger 420..441 CDD:275368 2/21 (10%)
COG5048 <424..583 CDD:227381 40/175 (23%)
C2H2 Zn finger 450..471 CDD:275368 8/23 (35%)
C2H2 Zn finger 478..498 CDD:275368 6/20 (30%)
zf-H2C2_2 490..513 CDD:290200 11/27 (41%)
C2H2 Zn finger 506..527 CDD:275368 6/25 (24%)
C2H2 Zn finger 535..555 CDD:275368 4/20 (20%)
C2H2 Zn finger 563..583 CDD:275368 5/20 (25%)
Zfp513NP_001012110.1 C2H2 Zn finger 152..172 CDD:275368 4/22 (18%)
zf-H2C2_2 164..189 CDD:290200 6/27 (22%)
COG5048 176..>228 CDD:227381 10/59 (17%)
C2H2 Zn finger 180..200 CDD:275368 3/27 (11%)
zf-H2C2_2 192..217 CDD:290200 4/32 (13%)
C2H2 Zn finger 208..228 CDD:275368 4/20 (20%)
C2H2 Zn finger 362..382 CDD:275368 8/22 (36%)
COG5048 <372..>450 CDD:227381 24/83 (29%)
zf-H2C2_2 374..399 CDD:290200 6/25 (24%)
C2H2 Zn finger 390..410 CDD:275368 6/20 (30%)
zf-H2C2_2 402..425 CDD:290200 9/23 (39%)
COG5048 414..>487 CDD:227381 17/78 (22%)
C2H2 Zn finger 418..438 CDD:275368 6/25 (24%)
C2H2 Zn finger 446..466 CDD:275368 4/20 (20%)
zf-H2C2_2 458..481 CDD:290200 6/23 (26%)
C2H2 Zn finger 474..493 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24403
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.