DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1603 and Rest

Sequence 1:NP_001260778.1 Gene:CG1603 FlyBaseID:FBgn0033185 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_035393.2 Gene:Rest MGIID:104897 Length:1082 Species:Mus musculus

Alignment Length:407 Identity:90/408 (22%)
Similarity:147/408 (36%) Gaps:121/408 (30%)


  Fly   242 NVLFTVEELKK---TLEQLHVQYTLAL--------------ETKQRGKLVGLAARYFAKCEFLSV 289
            |.::.:.||.|   ...||.:...:||              |.:|..:|:.:...:|::.|...:
Mouse    28 NDMYDLHELSKAELAAPQLIMLANVALTGEASGSCCDYLVGEERQMAELMPVGDNHFSESEGEGL 92

  Fly   290 APVVTPRENEEDNDLTAIKLNFKEENLITTSFIETYANYPVLYNQALPDFGSIEIRADAFKRMAK 354
                     ||..||..:      ||:                     :.||:|:       .|.
Mouse    93 ---------EESADLKGL------ENM---------------------ELGSLEL-------SAV 114

  Fly   355 EFQPVVKANETDVYIAVNK----LRRWLYDAIRRLKSKELIQKC---------SKQEVQYLQMCS 406
            |.|||.:|:......:.||    ......|..|..|:|..  :|         .:|.|.::::.|
Mouse   115 EPQPVFEASAAPEIYSANKDPAPETPVAEDKCRSSKAKPF--RCKPCQYEAESEEQFVHHIRIHS 177

  Fly   407 ---FLPAKGSESQV-------------------LYCDYC----DKRFHGDYNLRVHIVKAHEVGD 445
               |...:.:|.|.                   :.||.|    ::..|...:|:.|: :|.| .:
Mouse   178 AKKFFVEESAEKQAKAWESGSSPAEEGEFSKGPIRCDRCGYNTNRYDHYMAHLKHHL-RAGE-NE 240

  Fly   446 LPYLCSFCPRRFDRHVDMDRHKLRSHFERKL----KCQYCEKSFAVDTDLK----VHTLIHTGER 502
            ..|.|..|...........:| ||:||.||:    ||.|.       :|.|    .|...|||||
Mouse   241 RIYKCIICTYTTVSEYHWRKH-LRNHFPRKVYTCSKCNYF-------SDRKNNYVQHVRTHTGER 297

  Fly   503 PHVCDICGKTFRLKLLLDHHVNGVHLNIRPYSCNMCTKTFRKKFELANHIKG-HLNIRDKKCEYC 566
            |:.|::|..:...|..|..|:. .|...:|:.|:.|......:.|:..|.:. |...:...|.:|
Mouse   298 PYKCELCPYSSSQKTHLTRHMR-THSGEKPFKCDQCNYVASNQHEVTRHARQVHNGPKPLNCPHC 361

  Fly   567 DATFYDHSSLSRHRRSH 583
            |....|.|:..:|...|
Mouse   362 DYKTADRSNFKKHVELH 378

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1603NP_001260778.1 MADF_DNA_bdg 202..287 CDD:287510 13/62 (21%)
GT1 321..408 CDD:304916 20/103 (19%)
C2H2 Zn finger 420..441 CDD:275368 7/25 (28%)
COG5048 <424..583 CDD:227381 45/168 (27%)
C2H2 Zn finger 450..471 CDD:275368 5/21 (24%)
C2H2 Zn finger 478..498 CDD:275368 5/24 (21%)
zf-H2C2_2 490..513 CDD:290200 11/27 (41%)
C2H2 Zn finger 506..527 CDD:275368 5/21 (24%)
C2H2 Zn finger 535..555 CDD:275368 4/21 (19%)
C2H2 Zn finger 563..583 CDD:275368 6/20 (30%)
RestNP_035393.2 Interaction with SIN3A. {ECO:0000250|UniProtKB:Q13127} 32..117 23/128 (18%)
Interaction with SIN3B. {ECO:0000250|UniProtKB:Q13127} 43..57 4/14 (29%)
Interaction with ZFP90. {ECO:0000250|UniProtKB:Q13127} 140..413 60/253 (24%)
RPB9 154..251 CDD:224510 18/101 (18%)
Required for binding to the neuron-restrictive silencer element. {ECO:0000269|PubMed:11039732} 196..207 0/11 (0%)
C2H2 Zn finger 245..265 CDD:275368 5/21 (24%)
C2H2 Zn finger 273..293 CDD:275368 6/27 (22%)
zf-H2C2_2 285..310 CDD:290200 9/25 (36%)
COG5048 297..>376 CDD:227381 20/80 (25%)
zf-C2H2 299..321 CDD:278523 5/23 (22%)
C2H2 Zn finger 301..321 CDD:275368 5/21 (24%)
zf-H2C2_2 313..338 CDD:290200 6/26 (23%)
C2H2 Zn finger 329..350 CDD:275368 4/21 (19%)
C2H2 Zn finger 386..402 CDD:275368
Interaction with RCOR1. {ECO:0000250|UniProtKB:Q13127} 985..1063
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.