DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Coop and jigr1

Sequence 1:NP_001260776.1 Gene:Coop FlyBaseID:FBgn0263240 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001097920.1 Gene:jigr1 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster

Alignment Length:264 Identity:48/265 (18%)
Similarity:82/265 (31%) Gaps:113/265 (43%)


  Fly    43 LIAAVSRRPMLWLRNNANGQKRSDITPVWFEVGQDVNLPADICRIKWGHLRD--NFRKVYIRNNL 105
            ||......|:|:.|:|...:.:..:..:|.::...:...|...|.:...||:  |..|..:.|.|
  Fly    33 LIREYRSHPVLYDRSNKRFKDKLYVAHIWEQIAHKLGYDATSIRERMTTLRNRYNIEKRRVENGL 97

  Fly   106 SNETPSSWRFYNDMRFMEPAVHENIMRQTRSSSKKHPPGHWTENNNVLGPDKYDSMPIVATEPIC 170
            |.:: |.|..:..::|:...:     |..||                                  
  Fly    98 STQS-SQWPLFESLQFLGDHI-----RPRRS---------------------------------- 122

  Fly   171 ELSHSYDSELHQPSFSDISSFFEDRDCQPPENKRFKSEPSQREEDEE----DDDDFDEDAASENL 231
                                              ||: .|.:|||||    ||...|.:....::
  Fly   123 ----------------------------------FKN-MSVKEEDEETYEVDDCRSDSNGHMNSI 152

  Fly   232 EEERGNRADAASSGVFTIEVLDDDDEM---EQAVTKTKA-----NNTSHGGSSLKSEQEAKVFSN 288
            ::|                 |:||.|:   |||:..|..     ||:.....|.:|       :|
  Fly   153 KDE-----------------LEDDSEIFDCEQALPVTTVLGIPLNNSDEANKSQRS-------TN 193

  Fly   289 SQSP 292
            .:.|
  Fly   194 GEMP 197

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CoopNP_001260776.1 MADF 42..124 CDD:214738 19/83 (23%)
BESS 320..353 CDD:281011
jigr1NP_001097920.1 MADF 33..118 CDD:214738 19/91 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.