DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Coop and CG6276

Sequence 1:NP_001260776.1 Gene:Coop FlyBaseID:FBgn0263240 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_650445.3 Gene:CG6276 FlyBaseID:FBgn0038316 Length:470 Species:Drosophila melanogaster

Alignment Length:473 Identity:99/474 (21%)
Similarity:168/474 (35%) Gaps:151/474 (32%)


  Fly    16 SASAAASATASFAFTNTAKLPIETVKRLIAAVSRRPMLWLRNNANGQKRSDITPVWFEVGQDVNL 80
            |::...|.:||...|       |.|.:||..|.|...::...:.....|..:...|.||...:..
  Fly    13 SSNPNTSCSASRWLT-------EEVFKLIEIVQRDEAIYNPRHKYYFCRPYVENFWREVDLKLEK 70

  Fly    81 PADICRIKWGHLRDNFRKVYIRNNLSNETPSSWRFYNDMRFMEPAVHE----------------- 128
            .......||.:||.:||:.| .|.|..:.|..|.:::.|.|:.|.:.:                 
  Fly    71 NPGASLAKWTNLRISFRREY-TNYLEEKVPPCWSYFDRMFFLHPYLRKKHQQPKSLDTQVQDALA 134

  Fly   129 ---NI---MRQTRS---------------SSKKHPPGHWTENNNVLGPDKYDSMPIVATE--PIC 170
               |:   |::.||               |:.:.||....:|.    .|.:|......:|  .|.
  Fly   135 HLSNLSSRMQRERSVTIPGSSSIGGQPTPSAHQSPPAQQLDNY----LDYFDEAEHNNSELDDIM 195

  Fly   171 ELSHSYDSELH-QPSFSDISSFFEDRDCQPPENKRFKSEPSQREEDEEDDDDFDEDA---ASENL 231
            |.....:|..| |...:||.|     :|:.|.:. ::.|..:.||||:||.|..:.|   :|.:.
  Fly   196 EEEQQRNSRYHGQLDGNDIKS-----ECEEPVDD-YEQEAHEPEEDEQDDQDLHKMAPTSSSSSA 254

  Fly   232 EEER--GNRADAASSGV-FTIEVLDDDDEMEQAV------------------------------- 262
            |.:|  .|:...||..: ..:::....|||..|:                               
  Fly   255 EAQRRYANQHSHASRMLPGRLQMRTYHDEMRGAIRPRSQELQAPTAAVAGVNYSAQPTAHPNISF 319

  Fly   263 -------------TKTKANNTSHGG---------------------------SSLKSEQEAKVFS 287
                         |.|.|.....||                           ||:.:...:...|
  Fly   320 VRPTFSKPVDLVSTTTHAGGGGGGGVPGTAGLSEAELPTPSTAAVATPMAPSSSVSASSSSSYLS 384

  Fly   288 -----------NSQSPTADLPFKYISTDVATNTDPSGG----DLQDEADRMFLLSLMPFLQRLDS 337
                       :.|.|.:.||.:..:.:.:..:..:||    |.:.:.|.|||:||:|.:|:|:.
  Fly   385 QRHGHNHMHGGHPQVPPSALPLRLEANNASGGSVSNGGAELCDCKTDPDAMFLMSLLPDIQKLNG 449

  Fly   338 RRRLRVRQKLQNVLIEEL 355
            |.|.:::...||:|.:.|
  Fly   450 RDRGKIKIAFQNILQDYL 467

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CoopNP_001260776.1 MADF 42..124 CDD:214738 21/82 (26%)
BESS 320..353 CDD:281011 14/33 (42%)
CG6276NP_650445.3 MADF 32..116 CDD:214738 22/85 (26%)
BESS 431..465 CDD:281011 14/34 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.