DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Coop and hng2

Sequence 1:NP_001260776.1 Gene:Coop FlyBaseID:FBgn0263240 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_649837.1 Gene:hng2 FlyBaseID:FBgn0037634 Length:254 Species:Drosophila melanogaster

Alignment Length:342 Identity:58/343 (17%)
Similarity:105/343 (31%) Gaps:149/343 (43%)


  Fly    44 IAAVSRRPMLWLRNNANGQKRSDITPVWFEVG-------QDVNLP--ADICRI---KWGHLRDNF 96
            |.||.:|.::|.|::.|...|......|.::|       .|.:.|  .:|.:.   :|.:.||::
  Fly    22 IDAVHKRSIIWERSHPNFHNRELRDEAWQQIGHELCSNFDDSSEPEKQEIVKTLLKRWKNTRDSY 86

  Fly    97 RKVYIRNNLSNETPSSWRFYNDMRFMEPAVHENIMRQTRSSSKKHPPGHWTENNNVLGPDKYDSM 161
            .:|                             |.:||                            
  Fly    87 LRV-----------------------------NRLRQ---------------------------- 94

  Fly   162 PIVATEPICELSHSYDSEL------HQPSFSDISSFFEDRDCQP-PENKRFK---------SEPS 210
               :.|.:...|:.|:.||      ...|..|:.|..|    || |:.||.:         ..|.
  Fly    95 ---SGEEVARASYIYEKELSFLLNVKAESEDDVESLKE----QPKPQAKRKRVSTAAQRSAKTPR 152

  Fly   211 QREEDEEDDDD--FDEDAASENLEEERGN----RADAASSGVFTIEVLDDDDEMEQAVTKTKANN 269
            :|..|:|.:.:  ....|...|:....|:    :.|.|:..:..|..|..|...        :.|
  Fly   153 KRNSDQESNIEPAIRNPAIPSNINTVLGDLGCAKEDTATPEIAYIPQLPSDPPC--------STN 209

  Fly   270 TSHGGSSLKSEQEAKVFSNSQSPTADLPFKYISTDVATNTDPSGGDLQDEADRMFLLSLMPFLQR 334
            |:                            |:|.|               .|:.|..::.|.:|:
  Fly   210 TA----------------------------YLSAD---------------PDQAFFDTIKPHMQQ 231

  Fly   335 LDSRRRLRVRQKLQNVL 351
            :.:.|:|..:.::..:|
  Fly   232 MCADRKLDFQIEVLKIL 248

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CoopNP_001260776.1 MADF 42..124 CDD:214738 17/92 (18%)
BESS 320..353 CDD:281011 7/33 (21%)
hng2NP_649837.1 MADF_DNA_bdg 21..113 CDD:287510 25/151 (17%)
BESS 216..250 CDD:281011 8/49 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.