DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Coop and CG12768

Sequence 1:NP_001260776.1 Gene:Coop FlyBaseID:FBgn0263240 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001262229.1 Gene:CG12768 FlyBaseID:FBgn0037206 Length:429 Species:Drosophila melanogaster

Alignment Length:345 Identity:68/346 (20%)
Similarity:122/346 (35%) Gaps:97/346 (28%)


  Fly    41 KRLIAAVSRRPMLW---LRNNANGQKRSDITPVWFEVGQDVNLPADICRIKWGHLRDNFRKVYIR 102
            :|||..|...|:||   |.:.....||..|.  |.|:|:..|:..:..:..:..||:.||:....
  Fly    11 RRLIELVRLNPILWDCRLPHYKRSDKRKAIK--WNELGRLFNVNGERVQRTFTSLREIFRRELNH 73

  Fly   103 NNLSNET--PSSWRFYNDMRFMEPAVHENIMRQ-TRSSSKKHPP---GHWTENNNVLGPDKYDSM 161
            ..:...|  .|.|.:|:.|.|::..:.|...|: .:..|....|   |....|||          
  Fly    74 EKMLGTTRFKSKWEYYDAMAFLKEVIRERKSRERIKHGSLDSAPVATGSSNNNNN---------- 128

  Fly   162 PIVATEPICELSHSYDSELHQPSFSDISSFFEDRDCQPPENK-RFKSEPS--------------- 210
                    | :|.:..:.....:..|...:|...|...|.|: :.:.||.               
  Fly   129 --------C-VSRNSSNNNSSSAALDEYQYFAPSDPNNPNNQPQLQPEPKSSLPVTIPSLSLTLS 184

  Fly   211 ------QREEDEEDDDDFDEDAASENLEEERGNRADAASSGVFTIEVLDDDDEMEQAVTKTKANN 269
                  |::...........|....:|:                          :|::..:..|.
  Fly   185 QLPVALQQQAQHLQALQLQPDVTLTSLQ--------------------------KQSLPTSLTNA 223

  Fly   270 TSHGGSSLKSEQEAKVFSNSQSPTADLPFKYISTDVATNTDPSGGDLQD-------EADRMFLLS 327
            |.   :.|.....|:|.|:|:|.::. |..||..:..:   |:||..::       ||.|..|.:
  Fly   224 TP---APLAQTSPAQVLSSSRSCSSS-PSIYIKDEPCS---PAGGCPEEVMTGNGPEATRKKLAT 281

  Fly   328 LMPFLQRLDSRRRLRVRQKL 347
            :.|     .::::|:.|.:|
  Fly   282 IRP-----QTKQQLKARLQL 296

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CoopNP_001260776.1 MADF 42..124 CDD:214738 25/87 (29%)
BESS 320..353 CDD:281011 7/29 (24%)
CG12768NP_001262229.1 MADF 12..100 CDD:214738 25/90 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.