DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Coop and CG8765

Sequence 1:NP_001260776.1 Gene:Coop FlyBaseID:FBgn0263240 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_649141.1 Gene:CG8765 FlyBaseID:FBgn0036900 Length:690 Species:Drosophila melanogaster

Alignment Length:439 Identity:88/440 (20%)
Similarity:160/440 (36%) Gaps:121/440 (28%)


  Fly     4 AYNASSSAASVGSASAAASATASFAFTNTAKL---PIETV--------KRLIAAVSRRPMLWLRN 57
            |.|.|||||::.|..:..|| |....||..:.   ||.|.        |.||..:.:..|::...
  Fly   270 AANQSSSAATITSNVSTTSA-AHNQSTNAEEEDDDPIHTFLNMESYFEKELITLIQQEDMIYNYG 333

  Fly    58 NANGQKRSDITPVWFEVGQDVNLPADICRIKWGHLRDNFRKVY--IRNNLSNETPSSWRFYNDMR 120
            |.|.:.......||.|:.:.:......||:||..|||.:.:.:  :|..:..:..|.|:.||.:.
  Fly   334 NENYRNAKLKMEVWEEIARKLKKSVKQCRLKWKALRDQYAREHKRLRTLMHIDATSRWKHYNSLS 398

  Fly   121 FMEPAVHENIMRQTRSSS---KKHPP-----GHWTENNNVLGPDKYDSMPIVATEPICELSHSYD 177
            |::..:.:..:......|   .|:.|     .|.|:::         |.|   |:.|...|.|.:
  Fly   399 FLQKYIQQKTLESDSQLSMLLPKNDPVRELEDHMTQSH---------SPP---TQQITLESSSSN 451

  Fly   178 SELHQPSFSDISSFFEDRDCQPPENKRFKSEPSQREE---------------------------- 214
            |:|:.|:...::...:....|..:.:..:.:..|:.:                            
  Fly   452 SQLNLPTLPHLTGPHKAEQQQQQQQQEEQHQQQQQHQQQQQQQQASELCVATYDDMDIENYINGD 516

  Fly   215 ----DEEDDDDFDEDAASENLEEERGNRADAASSGVFTIEVLDDDDEMEQAV-----TKTKANNT 270
                |::.:||.||:..:....|:...:.|   ..|.|.:  .:|..:..||     ..:|....
  Fly   517 VHHNDDDVEDDEDEEMETTTAAEQPPQQQD---QHVMTYD--HEDGPVYMAVPSVGSAMSKQEQL 576

  Fly   271 SHGGSSLKSEQEAKV---------------FSN-SQSPTADLPFKYISTDV-----------ATN 308
            |.|.:||:::|....               :.| :.:|::....:|.|..:           ::|
  Fly   577 SDGATSLENQQLQSTAEFQKIEIQTPTTPRYQNAATTPSSTSTSRYHSAPITPSKPTHMEYPSSN 641

  Fly   309 TDPSGGDLQDEADRMFLLSLMPFLQRLDSRRRLRVRQKLQNVLIEELEF 357
            ...||.|  ||....|                ..|..|::|..:|.:.|
  Fly   642 GHNSGED--DEIGAFF----------------KAVSMKIRNAQLEPVAF 672

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CoopNP_001260776.1 MADF 42..124 CDD:214738 21/84 (25%)
BESS 320..353 CDD:281011 4/33 (12%)
CG8765NP_649141.1 MADF 42..123 CDD:214738
MADF 318..405 CDD:214738 21/87 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.