DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Coop and stwl

Sequence 1:NP_001260776.1 Gene:Coop FlyBaseID:FBgn0263240 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001261839.1 Gene:stwl FlyBaseID:FBgn0003459 Length:1037 Species:Drosophila melanogaster

Alignment Length:334 Identity:63/335 (19%)
Similarity:110/335 (33%) Gaps:105/335 (31%)


  Fly    43 LIAAVSRRPMLWLRNNANGQKRSDITPVWFEVGQDVNLPADICRIKWGHLRDNFRK---VYIRNN 104
            |:.:|.::..|:.|.:.|.:||......|..|..:|....:.|:.:|..||:::.:   ......
  Fly    11 LLRSVEKQTALYDRTDENYRKRLPSENAWDMVASEVGESVEKCKRRWRQLRNDYTRWCNADANRR 75

  Fly   105 LSNETPSSWRFYNDMRFMEPAVHENI--------------------------------------- 130
            .:.:...::...:::||::.  |.||                                       
  Fly    76 RNGQRRLAYPLADELRFLDR--HLNIADDMAADDDRSVSSDKDRDNNRDSEGVDHHAQASLKERA 138

  Fly   131 ---------------MRQTRSSSKKHPPGHWTENNNVLGPDKYDSMPIVATEPICELSHSYDSEL 180
                           :|:.:||..|..  :| ||..    ||..|....|.|.:.:|..|.:.|.
  Fly   139 SSTSKLVKEVKLASQVRKEKSSQDKRE--NW-ENPG----DKQRSRKKSAEEKLNDLEESDEPEK 196

  Fly   181 HQPSFSDISSFFEDRDCQPPENKRFKSEPSQREEDEEDDDDFDEDAASENLEE--------ERGN 237
            .....|.:.|..||.:|..             ||..||.:.||.|....|.|:        |:.|
  Fly   197 VPELDSFLQSDNEDDECMD-------------EEHLEDLEGFDFDLEQSNQEKELTPEKSLEKNN 248

  Fly   238 RADAASSGVFTIEVLDDD-------DEMEQAVTKTKANNTSHG----------GSSLKSEQEAKV 285
            .....|...|.::...|.       .....:..::||:.:..|          |.....:.|.:|
  Fly   249 TDSTVSQPEFFVKQTRDPRLLIIGRKNSTSSFAESKASKSISGDPLETAMEDSGDEYGRDGEKRV 313

  Fly   286 F-SNSQSPT 293
            . |::.|||
  Fly   314 TGSDTTSPT 322

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CoopNP_001260776.1 MADF 42..124 CDD:214738 16/84 (19%)
BESS 320..353 CDD:281011
stwlNP_001261839.1 MADF 11..98 CDD:214738 17/89 (19%)
BESS 604..637 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.