| Sequence 1: | NP_001260776.1 | Gene: | Coop / 35677 | FlyBaseID: | FBgn0263240 | Length: | 358 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_611558.2 | Gene: | hng1 / 37412 | FlyBaseID: | FBgn0034599 | Length: | 315 | Species: | Drosophila melanogaster |
| Alignment Length: | 341 | Identity: | 68/341 - (19%) |
|---|---|---|---|
| Similarity: | 119/341 - (34%) | Gaps: | 91/341 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 43 LIAAVSRRPMLW---LRNNANGQKRSDITPVWFEVGQDVNLPADICRIKWGHLRDNFRKVYIRNN 104
Fly 105 LSNETPSSWRFYND----MRFMEPAVHENIMRQTRSSSKKHPPGHWTENNNVLGPDKYDSMPIVA 165
Fly 166 TEPICEL--SHSYDS-----------ELHQPSFSDISSFFEDRDCQPPENKRFKSEPSQREEDEE 217
Fly 218 DDDDFDEDAASENLEEERGNRADAASSGVFTIEVLDDDDEM--EQAVTKTKANNTSHG------- 273
Fly 274 ---GSSLKSEQEAKVFSNSQSPTADLPFKYISTDVATNTDPSGGDLQDEADRMFLLSLMPFLQRL 335
Fly 336 DSRRRLRVRQKLQNVL 351 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Coop | NP_001260776.1 | MADF | 42..124 | CDD:214738 | 21/87 (24%) |
| BESS | 320..353 | CDD:281011 | 6/32 (19%) | ||
| hng1 | NP_611558.2 | MADF | 15..98 | CDD:214738 | 21/88 (24%) |
| BESS | 264..298 | CDD:281011 | 7/49 (14%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||