DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Coop and brwl

Sequence 1:NP_001260776.1 Gene:Coop FlyBaseID:FBgn0263240 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_609298.1 Gene:brwl FlyBaseID:FBgn0032130 Length:435 Species:Drosophila melanogaster

Alignment Length:410 Identity:85/411 (21%)
Similarity:134/411 (33%) Gaps:124/411 (30%)


  Fly     4 AYN--------ASSSAASVGSASAAASATASFAFTNTAKLPIETVKRLIAAVSRRPMLW------ 54
            |||        :.::.||:||.:....|...|..            |.:..|.....|:      
  Fly    26 AYNHHSPTGSGSGTAGASIGSTNRVMQADEDFNI------------RFVNLVRTHKCLYDKKVPE 78

  Fly    55 LRNNANGQKRSDITPVWFEVGQDVNLPADICRIKWGHLRDNFRKVYIRNNLSNETPSSWRFY--N 117
            .||..|.:|      .|..:.::.......|:.:|.:||....: ||:....:| |....:|  .
  Fly    79 YRNRDNQEK------AWVLISKETRESVIHCKERWRNLRACLSR-YIKQQSGSE-PQHKPYYLTE 135

  Fly   118 DMRFMEPAVHENIMRQTRSSSKKHPPGHWTENNNVL------GPDKYDSMPIV------ATEPIC 170
            .|.|:.|     .::.:|:|         .|.||.|      ........|.:      |||   
  Fly   136 HMAFLLP-----FLKSSRNS---------LEGNNSLATLYQMSQQHLQHQPFLLHPALHATE--- 183

  Fly   171 ELSHSYDSELHQPSFSDISSFFEDRDCQPPENKRFKSEPSQREEDEEDDDDFD------------ 223
              .|.|.:.....:.::.:........:..|.|...||    ::|||..|.||            
  Fly   184 --EHKYCANTSINNNNNNNDVHNGESMEVLEMKYSISE----KDDEETIDAFDPAVTNTLGMNRT 242

  Fly   224 --EDAASENLEEERGN---RADAASSGVFTIEVLDDDDEMEQAVTKTKANNT------SHGGSSL 277
              ....|..|:...||   |:|.||:           |.|:..:...:...|      |.||...
  Fly   243 SSTPTRSSALQGGGGNSPARSDTASA-----------DSMKNFIPDVQLAETGSQLIYSDGGHGT 296

  Fly   278 --------KSEQEAKVFSNSQSPTADLP--FKYISTDV-ATNTDPSGGDL------QDEADRMFL 325
                    .|.......|....|.:..|  .|.|.|:. ||:|..:.|.:      .:.||..|.
  Fly   297 PPPLHYHPHSHPHPLTLSMDHHPASYEPGSTKRIKTECEATSTMTNAGSIYGGLSSSEVADMEFF 361

  Fly   326 LSLMPFLQRL--DSRRRLRV 343
            .|::|.|..|  ..||:.::
  Fly   362 RSILPDLATLTPQQRRKFKI 381

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CoopNP_001260776.1 MADF 42..124 CDD:214738 19/90 (21%)
BESS 320..353 CDD:281011 9/27 (33%)
brwlNP_609298.1 MADF 60..145 CDD:214738 20/98 (20%)
BESS 356..389 CDD:281011 9/27 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.