DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Coop and CG45071

Sequence 1:NP_001260776.1 Gene:Coop FlyBaseID:FBgn0263240 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_730024.1 Gene:CG45071 FlyBaseID:FBgn0266441 Length:429 Species:Drosophila melanogaster

Alignment Length:437 Identity:78/438 (18%)
Similarity:148/438 (34%) Gaps:149/438 (34%)


  Fly    40 VKRLIAAVSRRPMLWLRN-NANGQKRSDITPVWFEVGQDVNLPADICRIKWGHLRDNFRKVY--- 100
            |::.|..:..||.:|.|| :.|   ::.:..:|.|:.....||..:.:.||..||||||..|   
  Fly    12 VEQFIHDIEERPAIWNRNFHCN---KAFLEQMWDELSGAHKLPKIVLKAKWKGLRDNFRVEYKRI 73

  Fly   101 -------------------------------IRNNL-SNETPSSWRFYN-----DMRFMEPAVHE 128
                                           :|:.| .||...|:.|..     :...:||.:..
  Fly    74 PRADNGDFMVDPATFESKWLHYYALLFLTDHMRHRLPKNEQDQSFYFSQQSEDCEKTVVEPDLTN 138

  Fly   129 NIMRQTRSSSKKHPPGHWTENNNVLGPDKYDSMPI---------VATEPICELSHSYDSELHQ-- 182
            .::|:.:.|.:.:.......:.........::||.         |:|.|:...:.....|.||  
  Fly   139 GLIRRLQDSDEDYDEEEMEADGEASEATMEETMPTPPAAHQMNQVSTTPLATGALRAQEEAHQHA 203

  Fly   183 --------PSFSDISSFFEDRDCQPPENKRFKS--EPSQREEDEEDDDDFDEDAA---------- 227
                    ....::....||...:||..::..|  .||.:...|       ..||          
  Fly   204 LIKAGLLRAQLMELEKEAEDLSRKPPPPQQMTSPVAPSLQVLVE-------PPAAHCSPPPMVTT 261

  Fly   228 SENLEEERGNRADAASSGVFTIEVLDDDDEMEQAVTKTKANNTSHGGSSL---KSEQEAKVFSNS 289
            :....::.|:.|..|.:                  |.|.|::.|..|:.:   :|.....:::.:
  Fly   262 TSAQVQQPGSAAVLAPA------------------TTTSASSVSSNGAPMGGKRSVSPPPLYNKA 308

  Fly   290 QSPTADLPFKYISTDVATN----TDPSGGD----------------------------------- 315
            ..|.|.|...:::......    |...||:                                   
  Fly   309 HHPLATLAAAHLAAKDRNEDFGPTSAVGGNGDHLSFTQHSYANGLIPALKLKRPRLSEDSNFNGS 373

  Fly   316 -------LQDEADRMFLLSLMPFLQRLDSRRRLRVRQKLQNVLIEEL 355
                   :.::.|..:||||.|::::|.:.::||:|.|:|.::.:||
  Fly   374 STMDTPLVPEDDDYHYLLSLHPYMKQLTAAQKLRIRTKIQKLIFKEL 420

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CoopNP_001260776.1 MADF 42..124 CDD:214738 27/123 (22%)
BESS 320..353 CDD:281011 12/33 (36%)
CG45071NP_730024.1 MADF 14..106 CDD:214738 20/95 (21%)
BESS 384..418 CDD:281011 12/34 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12243
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.