DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Coop and madf-9

Sequence 1:NP_001260776.1 Gene:Coop FlyBaseID:FBgn0263240 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_500389.2 Gene:madf-9 WormBaseID:WBGene00022608 Length:333 Species:Caenorhabditis elegans

Alignment Length:333 Identity:65/334 (19%)
Similarity:123/334 (37%) Gaps:70/334 (21%)


  Fly    26 SFAFTNTAKLPIETVK----RLIAAVSRRPMLWLRNNANGQKRSDITPVWFEVGQDVNLPADICR 86
            :|...::..:.||...    ||||.|..||.|:.:::......|.....|.|:.:::...::..:
 Worm    32 NFLLASSKNMKIEETPVFNIRLIAEVKARPFLYDQSDEGYNLLSWRNSAWNEIAENLETTSEHVK 96

  Fly    87 IKWGHLRDNFRKVYIRNNLSNETPSSWRFYNDMRFMEPAVHENIMRQTRSSSKKHPPGHWTENNN 151
            .:|..|||.::|...:..:|.:. |||.|...::|::..:.:....:|                 
 Worm    97 TRWKTLRDRYKKEEKKERVSKKA-SSWVFQRPLKFIQAHLKDRHTDET----------------- 143

  Fly   152 VLGPDKYDSMPIVATEPICELSHSYDSELHQPSFSDISSFFEDRDCQPPENKRFKSEPSQREEDE 216
                |...|.|.|..||          ..|........||.|:...:..::.  ||..|..|.:.
 Worm   144 ----DSNQSEPAVKPEP----------NGHVSPMEAAMSFIENELIRTQDSS--KSSGSTGEMES 192

  Fly   217 EDDDDFDEDAASENLEEERGNRADAASSGVFTIEVLDDDDEMEQAVTKTKA--NNTSHGGSSLKS 279
            .........::|:|...:.|..|...:.....|.:         |||.:.:  ::.|:||.::|.
 Worm   193 SSASTASSASSSKNTGTQEGGEASVITPPPLPIPM---------AVTPSPSATSSASNGGPAVKR 248

  Fly   280 EQEAKVFSNSQSPTADLPFKYISTDVATNTDPSGG------------DLQDEADRMFLLSLMPFL 332
            .:.:  .:...:|.|       |.:.|.....|.|            ..::|.|.:|...:...|
 Worm   249 SRVS--ITEGMTPVA-------SRNAAAAAAASLGLSFFPGLSQWATTREEEEDEIFARMISIKL 304

  Fly   333 QRLDSRRR 340
            .:||:|.:
 Worm   305 SKLDARTK 312

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CoopNP_001260776.1 MADF 42..124 CDD:214738 22/82 (27%)
BESS 320..353 CDD:281011 6/22 (27%)
madf-9NP_500389.2 MADF 52..136 CDD:214738 22/85 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.