DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Coop and madf-3

Sequence 1:NP_001260776.1 Gene:Coop FlyBaseID:FBgn0263240 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_494766.1 Gene:madf-3 WormBaseID:WBGene00019218 Length:312 Species:Caenorhabditis elegans

Alignment Length:331 Identity:72/332 (22%)
Similarity:129/332 (39%) Gaps:59/332 (18%)


  Fly    42 RLIAAVSRRPMLWLRNNANGQKRSD--ITPVWFEVGQDVNLPAD--ICRIKWGHLRDNFRKVYIR 102
            |||.||.....|:  :|.:.|.|:.  ...||..:...:....|  :...:|..|||.:.|...:
 Worm     9 RLIEAVRHSRCLF--DNTDRQYRNTEYKNRVWQRLVTVLGFDGDPRMLSARWKQLRDKYGKEKRK 71

  Fly   103 NNLSNETPSSWRFYNDMRFMEPAVHENIMRQTRSSSKKHPPG-HWTENNNVLGPDKYDSMPIVAT 166
            ....|| .|||:::..:.|::|.:.:   |...|.|:|.|.| |          :|. :.|....
 Worm    72 QKYGNE-KSSWQYFKHLHFLDPHMTD---RAEISPSRKEPTGVH----------EKI-AEPCFGK 121

  Fly   167 EPICELSHSYDSELHQPSFSDI-SSFFEDRDCQPP------ENKRFK-SEPSQREEDEEDDDDFD 223
            ..|.|:.       ..|...|: ...:...||:..      :..|:. :.||..::.::..|.: 
 Worm   122 NLILEVR-------RHPCLYDVRDPKYRHGDCRTQAWGMIIDKLRYPGTVPSIYKQWKKHRDRY- 178

  Fly   224 EDAASENLEEER--GNRADAASSGVFTIEVLDD----DDEMEQAVTKTKANNTSHGGSSLKSEQE 282
                   :.|:|  .|..|.....|.|.|:.||    |..:::......|.:...||::....|:
 Worm   179 -------VREKRRLRNLGDPNVQDVSTWEMYDDMAWIDQHLDEQQLSRCARSLKRGGNNDGGNQD 236

  Fly   283 AKVFSNSQSPTADLPFKYISTDVATNTDPSGGDLQDEADRMFLLSLMPFLQRLDSRRRLRVRQKL 347
                ..|.....|....|:   :.....|:.||:..:.|..|..|::..|:.|....|:..:|::
 Worm   237 ----EMSDYGDYDDDINYV---MMAEKRPNNGDVLLDGDSAFSASIVSDLRTLGEEARIIAKQQI 294

  Fly   348 QNVLIE 353
            . :|:|
 Worm   295 M-ILLE 299

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CoopNP_001260776.1 MADF 42..124 CDD:214738 23/86 (27%)
BESS 320..353 CDD:281011 8/33 (24%)
madf-3NP_494766.1 MADF 9..94 CDD:214738 24/88 (27%)
MADF 122..212 CDD:214738 20/105 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.