DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11141 and Hps5

DIOPT Version :8

Sequence 1:NP_001286159.1 Gene:CG11141 / 35672 FlyBaseID:FBgn0033177 Length:710 Species:Drosophila melanogaster
Sequence 2:NP_001005247.2 Gene:Hps5 / 246694 MGIID:2180307 Length:1126 Species:Mus musculus

Alignment Length:698 Identity:149/699 (21%)
Similarity:259/699 (37%) Gaps:178/699 (25%)


  Fly    34 ANLNLTCVDATEEFLAMGSDAGIVFWYNRHTGEMQKL----KAEVATRITCVRVVNSVEYMVAAG 94
            :.|..|.:..:.::||:||..|.:....: .|..|:|    :....::|.|..  :..:| ||..
Mouse    33 SRLRCTSIAVSRKWLALGSTGGGLNLIQK-DGWKQRLFLSHREGAISQIACCS--HDDDY-VAVA 93

  Fly    95 CANGQVSIFQIQKELPRDLDLVAPCTKSRPIERYTIRDLHK--CVVSCCEWSKNGMKLYSGDRQG 157
            .:.|.|.::::.:|           .:.:| ||..:...||  .|.:.| |....::::.||..|
Mouse    94 TSQGLVVVWELNQE-----------RRGKP-ERIHVSSEHKGRKVTALC-WDTAVLRVFVGDHVG 145

  Fly   158 VVVLTELD--YQAHLSKSV------EILSEAYEIVQLSVRQSYLLVATLYRCIVCQMDAQTSQWN 214
            .|...:|:  .||..:.:.      .:|:....:|||......|||::|.|..:|    .|.:..
Mouse   146 KVSAIKLNTLKQAKAAAAFVMFPVQTVLTVDSCVVQLDYLDGRLLVSSLTRSFLC----DTEREK 206

  Fly   215 ITQVGKKDRKQLIDCGAIFLKKQEA--NKPQLVCGRPGLRFWVADAAGNVSKTVIFRDAVLRSPT 277
            ..::|.|:|..  :.||.|...:.|  .:|.:.|.|||.|.|..:..|.|..|..|:..:...| 
Mouse   207 FWKIGNKERHG--EYGACFFPGRCAGGQQPVIYCARPGSRMWEVNFDGEVLSTHQFKKLLSMPP- 268

  Fly   278 WEIPILNPKQRSEPSGTHHTSASTSSTRHSGLADGDVGYVASSNFRQLYLYDGHDSLLVTHDDAT 342
              :|::.  .||||...|...:|.|      ||           |.:|.....|  .::|..:..
Mouse   269 --LPVIT--ARSEPQYDHTVGSSQS------LA-----------FPKLLHLSEH--CVLTWTEKG 310

  Fly   343 LYVLNLDRLKVEAVARGLRKILDFCVCGKEIFVLEGNRTLLRLAPLP--------------EPPN 393
            :|:.....::| .:...::.|.|..|...|:|.|..|..:..|:.|.              :...
Mouse   311 IYIFIPQNVQV-LLWSEVKDIQDVAVYKNELFCLHFNGKISHLSLLSVERCVERLLRRGLWDLAA 374

  Fly   394 KTAKVIFNPLMPPPV--PVLGSHLSQLESPIELQAEPVLQNAEECFEL-SPVEQLNLNV-PIEIA 454
            :|..:..|.::....  .:....|..|:|.::|.|         |.|| |.::.|.|.. |:|.|
Mouse   375 RTCCLFQNSIITSRARKTLTADKLEHLKSQLDLTA---------CSELISQLDDLILRFEPLESA 430

  Fly   455 VESPLTQQNRRLEI------------------FRRIGEMDFEQSIVHTTRKTSVGKPPEASGVGI 501
            ..|      ||..|                  .||..:.|.:...:|:...:...:..|.:    
Mouse   431 CSS------RRSSISSHESFSILDSGIYRIISSRRGSQSDEDSCSLHSQTFSEDERLKEFA---- 485

  Fly   502 VEIGHETHELRLPLTNAATLMEASYCQMENNGLASPLDMKAAF-----------------LQHLP 549
               .|:..|.......|....|::    .::.:.|.:|...||                 ||.:.
Mouse   486 ---SHQEEEQPEQGCGANRNEESA----SHSPVMSEVDKSEAFLPFSIALPFRSPSPLVSLQAVK 543

  Fly   550 DALSPTTLQKTVAEKAKTL--AAELDLP----------------------------EVHLAPLSQ 584
            |::| :.::|| .||..||  :.||..|                            |:|..|...
Mouse   544 DSVS-SFVRKT-TEKIGTLHGSPELKEPFESKDADRAHEEEVSAVTCPLEEDTEEKEIHQPPKED 606

  Fly   585 --EELHAVQAQT-PQISDPLIRCYPTHLEEASIQTSSRENATNPADDY 629
              :||.|..|:. .::.|||:...|..|....::..|:...|....|:
Mouse   607 RLQELTAATAEAMTKLLDPLVLFEPKVLRMVLLEWLSQLEKTFAMKDF 654

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11141NP_001286159.1 WD40 repeat 138..188 CDD:293791 13/58 (22%)
WD40 repeat 194..228 CDD:293791 9/34 (26%)
Hps5NP_001005247.2 WD40 repeat 37..75 CDD:293791 9/39 (23%)
WD40 repeat 81..117 CDD:293791 10/51 (20%)
WD40 repeat 126..165 CDD:293791 10/40 (25%)
WD40 repeat 173..210 CDD:293791 11/41 (27%)
WD40 repeat 218..257 CDD:293791 13/39 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3621
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4159
TreeFam 1 0.960
32.890

Return to query results.
Submit another query.