DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11141 and W09G3.6

DIOPT Version :8

Sequence 1:NP_001286159.1 Gene:CG11141 / 35672 FlyBaseID:FBgn0033177 Length:710 Species:Drosophila melanogaster
Sequence 2:NP_493417.1 Gene:W09G3.6 / 173249 WormBaseID:WBGene00012369 Length:1125 Species:Caenorhabditis elegans

Alignment Length:780 Identity:165/781 (21%)
Similarity:281/781 (36%) Gaps:228/781 (29%)


  Fly    18 EVIERIPAR-------LQRGFFPAN----LNLTCVDATEEFLAMGSDAGIVFWYNRHTGEMQK-- 69
            :.|:|||..       |....||||    :..|||.:|.:.|.:|:..|.|:.::|:..:.:.  
 Worm    17 DFIDRIPTHFLVELTSLDELAFPANSTKRVKYTCVASTSKSLCLGTSTGSVYIFSRYAAKSRSRT 81

  Fly    70 -----LKAEVAT----RITCVRVVNSVEYMVAAGCANGQVSIFQIQKELPRDLDLVAPCTKSRPI 125
                 :..:|.|    :|:.:.|..|.|.| |.|..:|:||:.|:....|..|....|.....| 
 Worm    82 NSGAPVPVQVFTTRDGQISTISVSPSEELM-AIGGDSGRVSVAQLNNGQPPTLIYSTPGDARSP- 144

  Fly   126 ERYTIRDLHKCVVSCCEWSKNGMKLYSGDRQGVVVLTELDYQAHLSKSVEILSEAY--------E 182
            :|          |:...||.:...:|||...|.:       ..|...|..:...|:        |
 Worm   145 DR----------VTALSWSADLKTVYSGHSSGTL-------HCHRLTSRSVFRAAHQKLMKFDGE 192

  Fly   183 IVQLSVRQSYLLVATLYRCIVCQMDAQTSQWNITQVGKKDRKQLIDCGAIFLKKQEANKPQLVCG 247
            |:|:...||::|:||.....:..:::.|    |.|||||.|......||.::..:.|   .:|..
 Worm   193 IIQIDTLQSHVLIATSLAAHLFHVESGT----IQQVGKKTRSSPAPLGACYVHGESA---FIVAA 250

  Fly   248 RPGLRFWVADAAGNVSKTVIFRDA--VLRSPTWEIPILNPKQRSEPSGTHHTSASTSSTRHSGLA 310
            ||..|.|.|:..|.|.:|..:|.:  :.|:|........|...::..|.|..:...|..:     
 Worm   251 RPNGRLWEANLVGVVYRTHQYRQSGQIPRAPPISFRSAFPTDSAQFCGLHPDNQDVSLQK----- 310

  Fly   311 DGDVGYVASSNFRQLYLYDGHDSLLVTHDDATLYVLNLDRLKVEAVARGLRKILDFCVCGKEIFV 375
               :..:...|       .|..||:|:...:.:.|:.::..:|...|.....|||...||.:|||
 Worm   311 ---IHVIHVDN-------GGGRSLVVSTAGSRICVVEMETSRVTCCAELDYDILDVSTCGNDIFV 365

  Fly   376 L-------------EGNRTLLRLAPLPEPPNKTAKVIF----------NPLMPPPVPVLGS---- 413
            |             |..:||.:|         ..|.||          :|.:..|:|:|.:    
 Worm   366 LLNDSKGLRKFSVFERQKTLEKL---------NLKGIFMQSAQLVLFCSPHITYPMPLLTTIIEG 421

  Fly   414 ------------------------------------HLSQLESPIELQAEP-----------VLQ 431
                                                .:.:.||..:|:..|           |||
 Worm   422 LGTLSRKKETEKLQLALQKMLDERKINQSTYDNNIEEMERKESLKKLKKTPESKKLPSGVHRVLQ 486

  Fly   432 NAEEC------FELSPVEQLNLN-----------VPIEIAVESPLTQQNRRLEIFRRIGEMDF-E 478
            .|.:|      |..|..:.|...           :|:|.....|.:.:.|: |.:|:.|..|. |
 Worm   487 TAAQCSGYDDDFNFSTPQALRERSRSSPCGPESPIPLEKRASEPASLELRQ-EYWRKNGTPDVCE 550

  Fly   479 QSIVHTTRKTSVGKPPEASGVGIVE----------IGHETHELRLPLTNAATLMEASYCQMENNG 533
            :.|:|..|:....:..|.    :||          .|.:..|:|  .|...|:..|:....| ..
 Worm   551 EDILHRARQILEDENSEK----LVEKESLRTLLQLEGIKKDEIR--FTPTVTIANAAKALAE-LA 608

  Fly   534 LASPLDMKAAF----LQHLPDALSPT---------------------TLQKTVAEKAKTLAAELD 573
            ||.|:|:.|.:    .|:..:..:|.                     .||.|..:...|: ..:.
 Worm   609 LAVPVDLTAIWNSGNSQNSQNPQNPEKNGSKISKNPPQIVKVIRPGHRLQTTTTKPIATV-TPIT 672

  Fly   574 LPEVHLAPLSQEELHAVQAQTPQISDPL---------IRCYPTHLEEASIQTSSRENATN-PADD 628
            :|..:...::...:..:..:..:..|.:         |:.:.:|..:..|.|||..::.| |..|
 Worm   673 VPVANADDVAVNNMGMISEEMRRKQDEMWLDLRLTQHIKKHSSHANDDVIITSSPTSSNNVPKSD 737

  Fly   629  628
             Worm   738  737

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11141NP_001286159.1 WD40 repeat 138..188 CDD:293791 13/58 (22%)
WD40 repeat 194..228 CDD:293791 11/34 (32%)
W09G3.6NP_493417.1 WD40 <88..178 CDD:295369 27/109 (25%)
WD40 repeat 99..134 CDD:293791 13/36 (36%)
WD40 repeat 147..187 CDD:293791 10/47 (21%)
WD40 repeat 195..228 CDD:293791 13/37 (35%)
WD40 repeat 236..276 CDD:293791 13/43 (30%)
WD40 repeat 283..339 CDD:293791 10/71 (14%)
WD40 repeat 353..394 CDD:293791 15/50 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C363549299
eggNOG 1 0.900 E1_KOG3621
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4159
TreeFam 1 0.960
54.730

Return to query results.
Submit another query.