DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11141 and hps5

DIOPT Version :8

Sequence 1:NP_001286159.1 Gene:CG11141 / 35672 FlyBaseID:FBgn0033177 Length:710 Species:Drosophila melanogaster
Sequence 2:NP_001083008.2 Gene:hps5 / 100037388 ZFINID:ZDB-GENE-070410-80 Length:1133 Species:Danio rerio

Alignment Length:795 Identity:170/796 (21%)
Similarity:294/796 (37%) Gaps:231/796 (29%)


  Fly    26 RLQRGFFPANLNLTCVDATEEFLAMGSDAGIVFWYNRHTGEMQKL----KAEVATRITCVRVVNS 86
            ||..|    .:..||:..:.::||:|:.||.:....| .|..|||    |....|:::|   ...
Zfish    28 RLDSG----RIKCTCLSVSRKWLALGTSAGGLHLIQR-DGWKQKLILTHKEGSITQVSC---CPH 84

  Fly    87 VEYMVAAGCANGQVSIFQIQKELPRDLDLVAPCTKSRPIERYTIRDLHK--CVVSCCEWSKNGMK 149
            .|..:|...:.|.|.::::..|           .:.|| ||.::...|:  .|.|.| |....::
Zfish    85 DEDFIAVATSQGLVVVWELHLE-----------RRGRP-ERASVSWEHRGVTVTSLC-WDTVALR 136

  Fly   150 LYSGDRQGVVVLTELDYQAHLSKS-------VEILSEA-YEIVQLSVRQSYLLVATLYRCIVCQM 206
            :::||..|.|...... .:.|.|.       |:.::.. ..:|||.....:|::::|.||.:|  
Zfish   137 VFAGDMGGKVSCVRAG-SSKLGKGSAFVIFPVQTVTTVDSRVVQLGYTDGHLVISSLSRCYLC-- 198

  Fly   207 DAQTSQWNITQVGKKDRKQLIDCGAIFLKKQEANK---------PQLVCGRPGLRFWVADAAGNV 262
              .|.:....:||.|:|..  :.||.||.:..|.:         |.|.|.|||.|.|.|..:|.|
Zfish   199 --DTEREKFWRVGNKERDG--EFGACFLTQGLAGQRGQLVGCPAPLLFCARPGSRIWEASFSGEV 259

  Fly   263 SKTVIFRDAVLRSPTWEIPILNPKQRSEPSGTHHTSASTSSTRHSGLADGDVGYVASSNFRQLYL 327
            ..|..|:..:...|   :|:::.|  :||   |.....|:.              .|..|.:|..
Zfish   260 LSTHQFKQLLAVPP---LPLVSCK--NEP---HFNPTQTNP--------------QSLAFPRLLQ 302

  Fly   328 YDGHDSLLVTHDDATLYVLNLDRLKVEAVARGLRKILDFCVCGKEIFVLEGNRTLLRLAPLPEPP 392
            :.  |..|:|..|:.:|:......:| .:...::.:|:..|...::|.|.|:..|          
Zfish   303 FG--DQNLLTWTDSAIYIFTPHSGQV-LLWTEVKDVLEISVFRNDLFCLHGDGHL---------- 354

  Fly   393 NKTAKVIFNPLMPPPVPVLGSHLSQLESP---IE-----------------LQAEPVLQNAEECF 437
                                ||:| |.||   :|                 .|.......|.:..
Zfish   355 --------------------SHMS-LVSPDRCVERLMKRENWTIAATVCCMFQHAITTSKARKSL 398

  Fly   438 ELSPVEQLNLNVPIEIAVESPLTQQ--NRRLEIFRRIGEMDFEQSIVHTTRKTSVGKPPEASGV- 499
            .:..:|.|      :..:.|...||  .:..|:..::..:|...|    :|::|:.. .|:..| 
Zfish   399 SIDRLEHL------KAQLNSTSQQQLIGQLEEVISKLEPLDSACS----SRRSSISS-HESFNVL 452

  Fly   500 --GIVEI----GHETHELRLPLTNAA-----TLMEASYCQME--NNGLAS--------------- 536
              ||..:    |.::.:....|.|.:     .|.|.|:.:.|  :|..||               
Zfish   453 DCGIYRVISRRGSQSDDDASSLANQSMLEEERLKEFSFTEEEQVDNDSASVRGEGDRSDLGLQFL 517

  Fly   537 PLDMKA----AFLQHLPDALSPTTLQKTVAEKAKTLAAELDL---PEVH----------LAPLSQ 584
            ||..::    ..||.:.|::|  :..|...||..||....||   |::.          .:|:|:
Zfish   518 PLPFRSKPPRVALQAVRDSVS--SFMKKTTEKINTLQMNADLWPRPDLREGVQGEVASTASPISE 580

  Fly   585 E--------------ELHAVQAQT----PQISDPLIRCYPTHLEEASIQTSS-RENATNPADDYH 630
            |              ||..::|.|    .||.||::...|..|.:...:.:. .|.|..|.|.  
Zfish   581 ESEQELNTEESSSESELLELRAATKKAISQIQDPMVLLDPLCLSDVLQEWAPVLERALGPEDQ-- 643

  Fly   631 VGEPVDGIRSFGVSKRKMAPLKFVLS-------QPK----PTLKLEE---NRDDEEYTSFLP--- 678
                :..:.:....::.:...:.|.|       ||:    |....:|   :.::|::....|   
Zfish   644 ----ILPVETTNPEEKTLEEEELVSSMSCCVVVQPEISTSPAADPDESATHTEEEDFRESTPCSI 704

  Fly   679 -DFRRAGDPLAIHKE 692
             ..|....|||.|.|
Zfish   705 APVRAQFPPLANHVE 719

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11141NP_001286159.1 WD40 repeat 138..188 CDD:293791 13/58 (22%)
WD40 repeat 194..228 CDD:293791 9/34 (26%)
hps5NP_001083008.2 WD40 repeat 36..71 CDD:293791 12/36 (33%)
WD40 repeat 77..120 CDD:293791 11/58 (19%)
WD40 repeat 125..163 CDD:293791 10/40 (25%)
WD40 repeat 171..202 CDD:293791 9/35 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3621
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4159
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
32.890

Return to query results.
Submit another query.