DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11141 and hps5

DIOPT Version :8

Sequence 1:NP_001286159.1 Gene:CG11141 / 35672 FlyBaseID:FBgn0033177 Length:710 Species:Drosophila melanogaster
Sequence 2:NP_001090726.1 Gene:hps5 / 100036709 XenbaseID:XB-GENE-5931110 Length:1105 Species:Xenopus tropicalis

Alignment Length:800 Identity:170/800 (21%)
Similarity:294/800 (37%) Gaps:239/800 (30%)


  Fly    36 LNLTCVDATEEFLAMGSDAGIVFWYNRHTGEMQKL----KAEVATRITCVRVVNSVEYMVAAGCA 96
            |..||:..:.::||:||..|.:....| .|..|:|    |....:|::|   ....|..||...:
 Frog    35 LKCTCLSVSRKWLALGSSGGGLNLIQR-DGWKQRLILTHKEGAISRVSC---CGHDEDYVAVATS 95

  Fly    97 NGQVSIFQIQKELPRDLDLVAPCTKSRPIERYTIRDLH--KCVVSCCEWSKNGMKLYSGDRQGVV 159
            .|.|.::::.:|           .:.:| ||..:...|  :.|.:.| |....::::.||..|.|
 Frog    96 QGIVVVWELNQE-----------RRGKP-ERIYVSTEHRGRKVTALC-WDTTVLRVFVGDHLGKV 147

  Fly   160 VLTELDYQ-------AHLSKSVEILSEA-YEIVQLSVRQSYLLVATLYRCIVCQMDAQTSQWNIT 216
            ...:|:..       |.:...|:|::.. ..:|||......||:::..|..:|    .|.:....
 Frog   148 TAIKLNSSKQGKVAPAFVMFPVQIITTVDSRVVQLDYLDGKLLISSRTRSYLC----DTEREKFW 208

  Fly   217 QVGKKDRKQLIDCGAIFL---KKQEANKPQLVCGRPGLRFWVADAAGNVSKTVIFRDAVLRSPTW 278
            ::|.|:|..  :.||.|.   :.....:|.:.|.|||.|.|..:..|.|..|..|:. :|.||  
 Frog   209 KIGNKERDG--EYGACFFPAGRNLAGQQPLIYCARPGSRMWEVNFEGEVQSTHQFKQ-LLSSP-- 268

  Fly   279 EIPILNPKQRSEPSGTHHTSASTSSTRHSGLADGDVGYVASSNFRQLYLYDGHDSLLVTHDDATL 343
            .:||::|:...:...|.....|.:                   |.:| ||....|:| |..|..:
 Frog   269 PLPIIHPRLDLQYDSTQRPPQSLA-------------------FAKL-LYLSEHSVL-TWTDRAI 312

  Fly   344 YVLNLDRLKVEAVARGLRKILDFCVCGKEIFVLEGNRTLLRLAPLPEPPNKTAKVIFNPLMPPPV 408
            |:.....::| .:...:|.|.|..:...::|.|                :...||          
 Frog   313 YIFIPQNVQV-LLWSEVRDIQDISIYKNDLFCL----------------HHDGKV---------- 350

  Fly   409 PVLGSHLSQLESPIELQAEPVLQNAEECFELS--------------------PVEQL-NLNVPIE 452
                ||.|.|  |:|...|.:::  ..|::::                    |:::| :|...::
 Frog   351 ----SHFSLL--PVERCVERLIK--RNCWDVAARVCHLFQNIIVLSKGRKVLPMDKLEHLKAQLD 407

  Fly   453 IAVESPLTQQN--RRLE-IFRRIGEMDFEQSIVHTTRKTSVGKPPEASGV---GIVEI----GHE 507
            |     :|||.  .:|| :..::..:|...|    :|::|:.. .|:..|   ||..:    |.:
 Frog   408 I-----VTQQESIAQLEDLMSKLEPLDSACS----SRRSSISS-HESFNVLDCGIYRVISRRGSQ 462

  Fly   508 THE-----LRLPLTNAATLMEASYCQMENNG------------------LASPLDMKAAF----- 544
            :.|     ....|:....|.|.|..|.|..|                  :..|.:::..|     
 Frog   463 SDEDCESLHSQTLSEDDRLRELSLQQEEEQGDLDSVSHASVTVDSDRNEILLPFNIQLPFRSTSP 527

  Fly   545 ---LQHLPDALSPTTLQKTVAEKAKTLAAE---------------LDLPEVHLAPLSQEELHAVQ 591
               ||.:.|  |.|:..:...||..||...               ||:|...||. .:||.:.|.
 Frog   528 RVSLQAMKD--SVTSFVRKTTEKIGTLHMNPDIRMRQEVKEDDRLLDVPANDLAQ-PEEEKNEVD 589

  Fly   592 AQTP-------------------QISDPLIRCYP-----------THLEEA-SIQTSSREN---- 621
            :..|                   :|.||.|...|           .:||:| ..||.|.:.    
 Frog   590 SHHPSCEEVSLGELKLSTAAAISKIQDPEILFDPEAMVTILCKWLPYLEKAFGHQTDSSDQDSDG 654

  Fly   622 ---ATNPADDYHVGEPVDGIRSFGVSKRKMA----PLKFVLSQPKPTLKLEEN-RDDEEYTSFL- 677
               ||:.:.:...||.:....:.|..:..:.    |:.|.::.|.|   :||. |.|..:.:.| 
 Frog   655 DVPATSSSCNNEEGEELAMTETEGRGQTDLTKTEHPVIFRVTAPFP---IEEGVRRDLSHLAMLC 716

  Fly   678 ---PDFRRAGDPLAIHKETP 694
               ..|....|||....::|
 Frog   717 LEFKVFTDGKDPLPSDLDSP 736

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11141NP_001286159.1 WD40 repeat 138..188 CDD:293791 13/58 (22%)
WD40 repeat 194..228 CDD:293791 7/34 (21%)
hps5NP_001090726.1 WD40 repeat 218..258 CDD:293791 12/40 (30%)
WD40 repeat 37..72 CDD:293791 11/36 (31%)
WD40 repeat 78..118 CDD:293791 11/55 (20%)
WD40 repeat 126..173 CDD:293791 11/48 (23%)
WD40 repeat 181..210 CDD:293791 7/33 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3621
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
21.860

Return to query results.
Submit another query.