DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fa2h and FAH1

Sequence 1:NP_610279.3 Gene:fa2h FlyBaseID:FBgn0050502 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_181023.1 Gene:FAH1 AraportID:AT2G34770 Length:237 Species:Arabidopsis thaliana

Alignment Length:232 Identity:90/233 (39%)
Similarity:129/233 (55%) Gaps:23/233 (10%)


  Fly   120 VDWSKAMLPQIANITDCYDEWVHKPV---DRPLRLFDPWYLEMCTKTPWWLVPLFWIPVIVKCAV 181
            ||..|.::.|:.::.:.|:||||:|:   :.| |.|...:.|..|.|.||.||:.|:||:|.|..
plant     8 VDLKKPLVFQVGHLGEDYEEWVHQPIATKEGP-RFFQSDFWEFLTLTVWWAVPVIWLPVVVWCIS 71

  Fly   182 EEFTTAWQDSNQLAVFSGYFLFGVLLWSFLEYTLHRWVFHVKLSNKSGSWLCTFHFMIHGLHHKV 246
            ...:...    .|.......:.|:.:|:|.||.|||:|||:|..:   .|..|.|::|||.|||.
plant    72 RSVSMGC----SLPEIVPIVVMGIFIWTFFEYVLHRFVFHIKTKS---YWGNTAHYLIHGCHHKH 129

  Fly   247 PFDPMRLVFPPLPGAVL-------AAVIYTPLSFVLSHPRVILSGALAGYLCYDMMHYYLHYGNP 304
            |.|.:||||||...|:|       |..|.||     |....:..|.:.||:.||:.|||||:..|
plant   130 PMDHLRLVFPPTATAILCFPFWNIAKAISTP-----STAPALFGGGMLGYVMYDVTHYYLHHAQP 189

  Fly   305 SLWAFVHMKRYHHHHHFSHQTLGYGISSPLWDVVFKT 341
            :.....::|:||.:|||..|..|:||:|.|||:||.|
plant   190 TRPVTKNLKKYHLNHHFRIQDKGFGITSSLWDIVFGT 226

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fa2hNP_610279.3 Cyt-b5 6..73 CDD:278597
FA_hydroxylase 117..341 CDD:294712 89/231 (39%)
FAH1NP_181023.1 PLN02434 1..237 CDD:178053 90/233 (39%)
ERG3 <49..227 CDD:225546 76/191 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H56284
Inparanoid 1 1.050 180 1.000 Inparanoid score I1424
OMA 1 1.010
OrthoDB 1 1.010 D1049908at2759
OrthoInspector 1 1.000 T124900
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12863
Phylome 1 0.910 0.667 Consistency score
88.080

Return to query results.
Submit another query.