DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fa2h and fa2h

Sequence 1:NP_610279.3 Gene:fa2h FlyBaseID:FBgn0050502 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001038885.1 Gene:fa2h ZFINID:ZDB-GENE-031219-4 Length:102 Species:Danio rerio

Alignment Length:54 Identity:19/55 (35%)
Similarity:27/55 (49%) Gaps:3/55 (5%)


  Fly    26 YDLSRFMHKHPGGINTLKGLNSGDMTARFLKAPP--HSDAAMYLMREYKIDPED 77
            ||::.|:..|||| ..|....||...:..::.||  ||:.|...|.:|.|...|
Zfish    33 YDVTAFLRMHPGG-EALILRRSGKDISLEIEGPPHRHSENARRWMEQYYIGELD 85

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fa2hNP_610279.3 Cyt-b5 6..73 CDD:278597 17/49 (35%)
FA_hydroxylase 117..341 CDD:294712
fa2hNP_001038885.1 Cyt-b5 10..84 CDD:278597 18/53 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C306208693
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1049908at2759
OrthoFinder 1 1.000 FOG0004534
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12863
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.