DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fa2h and FA2H

Sequence 1:NP_610279.3 Gene:fa2h FlyBaseID:FBgn0050502 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_077282.3 Gene:FA2H HGNCID:21197 Length:372 Species:Homo sapiens

Alignment Length:361 Identity:126/362 (35%)
Similarity:194/362 (54%) Gaps:50/362 (14%)


  Fly    19 VKYRQQYYDLSRFMHKHPGGINTLKGLNSGDMTARFLKAPP--HSDAAMYLMREYKIDPEDSRKP 81
            |:...:.||||.|:..||||...|:.....|::|. |..||  ||..|...:.:|.:.       
Human    27 VRRGARLYDLSSFVRHHPGGEQLLRARAGQDISAD-LDGPPHRHSANARRWLEQYYVG------- 83

  Fly    82 KSSQRETLHHDEDGTLRQRPRETEDKNNNQVDDSME----------HLVDWSKAMLPQIANITDC 136
                  .|..::.|::...|...|:  ..:.|.:||          .||||.|.:|.|:.::.:.
Human    84 ------ELRGEQQGSMENEPVALEE--TQKTDPAMEPRFKVVDWDKDLVDWRKPLLWQVGHLGEK 140

  Fly   137 YDEWVHKPVDRPLRLFDPWYLEMCTKTPWWLVPLFWIPVIVKCA--------------VEEFTTA 187
            ||||||:||.||:|||....:|..:||.|:.||:.|:|:::..:              ...|||.
Human   141 YDEWVHQPVTRPIRLFHSDLIEGLSKTVWYSVPIIWVPLVLYLSWSYYRTFAQGNVRLFTSFTTE 205

  Fly   188 WQDSNQLAVFSGYFLFGVLLWSFLEYTLHRWVFHVKLSNKSGSWLCTFHFMIHGLHHKVPFDPMR 252
            :..:...::|.|.|:.|..|||.:||.:||::||:|..:.| .:|...||::||.|||.|||..|
Human   206 YTVAVPKSMFPGLFMLGTFLWSLIEYLIHRFLFHMKPPSDS-YYLIMLHFVMHGQHHKAPFDGSR 269

  Fly   253 LVFPPLPGAVLAAVIYTPLSFVLSHP--RVILSGALAGYLCYDMMHYYLHYGNPSLWAFVH-MKR 314
            |||||:|.:::..|.|..:..:|...  ..:.:|.|.||:.|||.|||||:|:|...:::: :|.
Human   270 LVFPPVPASLVIGVFYLCMQLILPEAVGGTVFAGGLLGYVLYDMTHYYLHFGSPHKGSYLYSLKA 334

  Fly   315 YHHHHHFSHQTLGYGISSPLWDVVFKT----RIHLR 346
            :|..|||:||..|:|||:.|||..|.|    :.||:
Human   335 HHVKHHFAHQKSGFGISTKLWDYCFHTLTPEKPHLK 370

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fa2hNP_610279.3 Cyt-b5 6..73 CDD:278597 20/56 (36%)
FA_hydroxylase 117..341 CDD:294712 97/251 (39%)
FA2HNP_077282.3 Cyt-b5 15..85 CDD:278597 20/72 (28%)
FA_hydroxylase 124..366 CDD:294712 96/243 (40%)
ERG3 <210..367 CDD:225546 66/158 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C306207026
eggNOG 1 0.900 E1_COG3000
Hieranoid 1 1.000
Homologene 1 1.000 H56284
Inparanoid 1 1.050 227 1.000 Inparanoid score I3434
Isobase 1 0.950 0 Normalized mean entropy S2267
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004534
OrthoInspector 1 1.000 T1073352
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12863
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R279
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.