| Sequence 1: | NP_610279.3 | Gene: | fa2h / 35670 | FlyBaseID: | FBgn0050502 | Length: | 355 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_079712.1 | Gene: | Msmo1 / 66234 | MGIID: | 1913484 | Length: | 293 | Species: | Mus musculus | 
| Alignment Length: | 250 | Identity: | 51/250 - (20%) | 
|---|---|---|---|
| Similarity: | 82/250 - (32%) | Gaps: | 97/250 - (38%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly   120 VDWSKAMLPQIANITDCYDEWVHKPVDRPLRLFDPWYLEMCTKTPWWLVPLFWIPVIVKCAVEEF 184 
  Fly   185 TTAWQDSNQLAVFSGYFLFGV--LLWSFLEYTLHRWVFHVKLSNKSGSWLCT-----FHFMIH-- 240 
  Fly   241 ---GLHH-----KVPFDPMRLVFPPLPGAVLAAVIYTPLSFVLSHPR--VILSGALAGYLCYDMM 295 
  Fly   296 HYYLHYGNPSLWAFVHMKR---YHH--HHHFSHQTLGYGISS----PLWDVVFKT 341 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| fa2h | NP_610279.3 | Cyt-b5 | 6..73 | CDD:278597 | |
| FA_hydroxylase | 117..341 | CDD:294712 | 50/248 (20%) | ||
| Msmo1 | NP_079712.1 | FA_hydroxylase | 143..274 | CDD:397991 | 18/64 (28%) | 
| Histidine box-1 | 157..161 | 1/10 (10%) | |||
| Histidine box-2 | 170..174 | 1/3 (33%) | |||
| Histidine box-3 | 249..255 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG3000 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||