DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fa2h and fa2h

Sequence 1:NP_610279.3 Gene:fa2h FlyBaseID:FBgn0050502 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001025677.1 Gene:fa2h XenbaseID:XB-GENE-1014400 Length:371 Species:Xenopus tropicalis

Alignment Length:347 Identity:128/348 (37%)
Similarity:193/348 (55%) Gaps:41/348 (12%)


  Fly    26 YDLSRFMHKHPGGINTLKGLNSGDMTARFLKAPP--HSDAAMYLMREYKIDPEDSRKPKSSQRET 88
            ||::.|::.||||...|:.....|:.|. |..||  ||:.|:..:.:|.:....:..|:      
 Frog    29 YDVTAFVNLHPGGERLLQDRAGKDIQAD-LNGPPHRHSENALRWLEQYYVGDLQAESPE------ 86

  Fly    89 LHHDEDGTLRQRPRETEDKNNNQVDDS---------MEHLVDWSKAMLPQIANITDCYDEWVHKP 144
             |..::  |:::|::.....:::.|.:         ...||||.|.:|.|:.::.:.||||||:|
 Frog    87 -HKPQN--LKEKPQQYSSATDHKEDSTGIQFKTFSPETDLVDWEKPLLWQVGHLREKYDEWVHQP 148

  Fly   145 VDRPLRLFDPWYLEMCTKTPWWLVPLFWIPVIV----KCAVE----------EFTTAWQDSNQLA 195
            |:||:|||...::|.|:||.|::|...|:||::    .|..|          .||..:.....:.
 Frog   149 VNRPIRLFHSDFVESCSKTAWYIVLSVWVPVVLYLSWYCLTELAQGNTRLFSSFTKDYSVPVPVF 213

  Fly   196 VFSGYFLFGVLLWSFLEYTLHRWVFHVKLSNKSGSWLCTFHFMIHGLHHKVPFDPMRLVFPPLPG 260
            .|...||.|||:|:.:||.:||:|||:. ...|..:|.|.|||:||.|||.|||..||||||:|.
 Frog   214 FFFPLFLIGVLVWTLMEYGIHRFVFHMN-PPASNYYLITLHFMLHGQHHKAPFDSSRLVFPPVPA 277

  Fly   261 AVLAAVIYTPLSFVLSHPRVILS---GALAGYLCYDMMHYYLHYGNPSLWAFV-HMKRYHHHHHF 321
            :.:...:|..:..:...| |.||   |.|.||:.|||.|||||||:|:..::: .:|.||..|||
 Frog   278 SFVIIPLYILVQLIFPVP-VGLSVFVGGLFGYVAYDMTHYYLHYGSPNKGSYLAWLKSYHVRHHF 341

  Fly   322 SHQTLGYGISSPLWDVVFKTRI 343
            .||..|:||:|.|||..|.|.|
 Frog   342 EHQKSGFGITSTLWDRPFNTLI 363

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fa2hNP_610279.3 Cyt-b5 6..73 CDD:278597 17/49 (35%)
FA_hydroxylase 117..341 CDD:294712 104/242 (43%)
fa2hNP_001025677.1 Cyt-b5 7..80 CDD:306642 17/53 (32%)
FA_hydroxylase 124..367 CDD:321361 104/242 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C306207053
eggNOG 1 0.900 E1_COG3000
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H56284
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1049908at2759
OrthoFinder 1 1.000 FOG0004534
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.