DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fa2h and faxdc2

DIOPT Version :9

Sequence 1:NP_610279.3 Gene:fa2h / 35670 FlyBaseID:FBgn0050502 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_998672.1 Gene:faxdc2 / 406828 ZFINID:ZDB-GENE-040426-2907 Length:323 Species:Danio rerio


Alignment Length:156 Identity:36/156 - (23%)
Similarity:51/156 - (32%) Gaps:55/156 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 LLWSFLEYTLHRWVFHVKLSNKSGSWLCTFHFMIHGLHHKVPFDPMRLVFPPLPGAVLAAVIYTP 270
            |:...|.|..||.|.|..|           :..||.:||:.          ..|..|:|...: |
Zfish   169 LMEEILFYYTHRLVHHPSL-----------YKSIHKIHHEW----------TAPVGVVALYAH-P 211

  Fly   271 LSFVLSHPRVILSGALAGYLCYDMMHYYLHYGNPSLWAFV------------HM-----KRYHHH 318
            :..|||:    :..||.|.|....     |....|||..:            |:     ..:|.:
Zfish   212 VEHVLSN----MLPALIGPLLLGS-----HVSTTSLWFTIALLVTTVSHCGYHLPLLPSPEFHDY 267

  Fly   319 HHFSHQTLGYGISSPLWDVVFKTRIH 344
            ||...... ||:...|      .|:|
Zfish   268 HHLKFNQC-YGVLGVL------DRLH 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fa2hNP_610279.3 Cyt-b5 6..73 CDD:278597
FA_hydroxylase 117..341 CDD:294712 34/151 (23%)
faxdc2NP_998672.1 ERG3 <159..288 CDD:225546 36/156 (23%)
FA_hydroxylase 164..288 CDD:282034 36/156 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3000
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.