DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fa2h and Fa2h

Sequence 1:NP_610279.3 Gene:fa2h FlyBaseID:FBgn0050502 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_835187.2 Gene:Fa2h MGIID:2443327 Length:372 Species:Mus musculus

Alignment Length:345 Identity:130/346 (38%)
Similarity:193/346 (56%) Gaps:42/346 (12%)


  Fly    26 YDLSRFMHKHPGGINTLKGLNSGDMTARFLKAPP--HSDAA-----MYLMREYKIDPEDSRKPKS 83
            |||:.|:..||||...|......|::|. |..||  |||.|     .|.:.|.:.||:|.     
Mouse    34 YDLTSFVRHHPGGEQLLLARAGQDISAD-LDGPPHRHSDNARRWLEQYYVGELRADPQDP----- 92

  Fly    84 SQRETLHHDEDGTLRQRPRETED---KNNNQVDDSMEHLVDWSKAMLPQIANITDCYDEWVHKPV 145
                    .|:|.:.....:..|   :...:|.|..:.||||.|.:|.|:.::.:.||||||:||
Mouse    93 --------TENGAVASAETQKTDPALEPQFKVVDWDKDLVDWQKPLLWQVGHLGEKYDEWVHQPV 149

  Fly   146 DRPLRLFDPWYLEMCTKTPWWLVPLFWIPVIVKCAVEEFTTAWQDSNQL--------------AV 196
            .||:|||....:|..:||.|:.||:.|:|:::..:...:.|..||:.:|              :|
Mouse   150 ARPIRLFHSDLIEAFSKTVWYSVPIIWVPLVLYLSWSYYRTLTQDNIRLFASLTREYSMMMPESV 214

  Fly   197 FSGYFLFGVLLWSFLEYTLHRWVFHVKLSNKSGSWLCTFHFMIHGLHHKVPFDPMRLVFPPLPGA 261
            |.|.|:.|:|.|:|:||.:||::||:|..:.| .:|...||::||.|||.|||..||||||:|.:
Mouse   215 FIGLFVLGMLFWTFVEYVIHRFLFHMKPPSNS-HYLIMLHFVMHGQHHKAPFDGSRLVFPPVPAS 278

  Fly   262 VLAAVIYTPLSFVLSHP--RVILSGALAGYLCYDMMHYYLHYGNPSLWAFVH-MKRYHHHHHFSH 323
            ::.|..|..|..:|...  .:|.:|.|.||:.|||.|||||:|:|...:::: ||.:|..|||.:
Mouse   279 LVIAFFYVFLRLILPETVGGIIFAGGLLGYVLYDMTHYYLHFGSPHKGSYLYNMKAHHVKHHFEY 343

  Fly   324 QTLGYGISSPLWDVVFKTRI 343
            |..|:|||:.|||..|.|.|
Mouse   344 QKSGFGISTKLWDYFFHTLI 363

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fa2hNP_610279.3 Cyt-b5 6..73 CDD:278597 20/54 (37%)
FA_hydroxylase 117..341 CDD:294712 100/241 (41%)
Fa2hNP_835187.2 Cyt-b5 11..85 CDD:278597 20/52 (38%)
FA_hydroxylase 124..372 CDD:294712 101/242 (42%)
ERG3 <208..365 CDD:225546 70/158 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C306207228
eggNOG 1 0.900 E1_COG3000
Hieranoid 1 1.000
Homologene 1 1.000 H56284
Inparanoid 1 1.050 234 1.000 Inparanoid score I3381
Isobase 1 0.950 0 Normalized mean entropy S2267
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004534
OrthoInspector 1 1.000 T1083434
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12863
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R279
TreeFam 1 0.960
1312.840

Return to query results.
Submit another query.