DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fa2h and D2023.1

Sequence 1:NP_610279.3 Gene:fa2h FlyBaseID:FBgn0050502 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001256372.1 Gene:D2023.1 WormBaseID:WBGene00014300 Length:337 Species:Caenorhabditis elegans

Alignment Length:130 Identity:22/131 (17%)
Similarity:50/131 (38%) Gaps:43/131 (33%)


  Fly   161 TKTPWWLVPLFWIPVIVKCAVEEFTTAWQDSNQLAVFSGYFLFGVLLWSFLEYTLHRWVFHVKLS 225
            ::..|.:..|||:|:              ::.::.::| .|:|...:      ..|.:||.::.:
 Worm    74 SRLAWLICDLFWVPI--------------NTMEILMYS-RFVFQTSI------AAHLFVFSIERA 117

  Fly   226 -----------NKSG-----SWLCTFHFMIHGLHHKVPFDPMRLVFPPLPGA------VLAAVIY 268
                       |.|.     |.:.|:.:.:..|:.|..|:..|.:...:.|.      ::..|:|
 Worm   118 IATCLSKRYEQNSSYPVIILSCILTYPYSLIQLYSKYNFEKGREINVVMYGGAGIVSLIILLVVY 182

  Fly   269  268
             Worm   183  182

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fa2hNP_610279.3 Cyt-b5 6..73 CDD:278597
FA_hydroxylase 117..341 CDD:294712 22/131 (17%)
D2023.1NP_001256372.1 Sre <96..>214 CDD:251743 17/95 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R279
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.