DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fa2h and Sc5d

Sequence 1:NP_610279.3 Gene:fa2h FlyBaseID:FBgn0050502 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_446094.1 Gene:Sc5d RGDID:620775 Length:299 Species:Rattus norvegicus

Alignment Length:204 Identity:47/205 (23%)
Similarity:73/205 (36%) Gaps:71/205 (35%)


  Fly   164 PWWLVP---LF--------------------WIPVIVKCAVEEFTTAWQDSNQLAVFSGYFLFGV 205
            ||..:|   ||                    ||.:|                 ::|.|..|...:
  Rat    85 PWISIPTVSLFLLELRGYSKLYDDIGDFPNGWIHLI-----------------MSVISFLFFTDM 132

  Fly   206 LLWSFLEYTLHRWVFHVKLSNKSGSWLCTFHFMIHGLHH--KVPFDPMRLVFPPLPGAVLAAVIY 268
            |:     |.:||.:.| :|..|.          ||..||  |:|.......|.|:.| .|.::.|
  Rat   133 LI-----YWIHRGLHH-RLLYKH----------IHKPHHIWKIPTPFASHAFHPVDG-FLQSLPY 180

  Fly   269 TPLSFVLSHPRVILSGALAGYLCYDMMHYYLHYGN---PSLW-AFVHMKRYHHHHH--FSHQTLG 327
            ....||....:|:..|.   |:..::....:|.|:   |.:: .|::...:|..||  |.:   .
  Rat   181 HIYPFVFPLHKVVYLGL---YVLVNVWTISIHDGDFRVPQIFRPFINGSAHHTDHHMLFDY---N 239

  Fly   328 YGISSPLWD 336
            ||....|||
  Rat   240 YGQYFTLWD 248

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fa2hNP_610279.3 Cyt-b5 6..73 CDD:278597
FA_hydroxylase 117..341 CDD:294712 47/205 (23%)
Sc5dNP_446094.1 ERG3 40..257 CDD:225546 47/205 (23%)
FA_hydroxylase 123..253 CDD:282034 39/150 (26%)
Histidine box-1 138..143 2/5 (40%)
Histidine box-2 151..155 2/4 (50%)
Histidine box-3 228..233 2/5 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3000
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.